PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.27895s0015.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family B3
Protein Properties Length: 248aa    MW: 28590.8 Da    PI: 9.2882
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.27895s0015.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B352.96.6e-171593695
                          EEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                    B3 36 ltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                          ++l++e+grsW++ l+ +k+ g+ ++++GW++F++angL++g +++Fkl++ ++++lv++
  Bostr.27895s0015.2.p  1 MILMNEKGRSWTLDLKQKKSCGTSYIRRGWRSFCHANGLRAGSIITFKLIK-EGGSLVLR 59
                          5799***********99999999**************************99.66666665 PP

2B350.73.1e-16127223299
                           EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                    B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                           ++ ++++++   + ++lp +f++ +g++ke  +++tl d++g +W+ kl   + ks+r  + +GWk+F +an +  +++++++l+++++
  Bostr.27895s0015.2.p 127 VTLTLKPYSILCSVMRLPVPFTRINGINKE--TKMTLLDKHGMKWSTKLHLeDDKSKRLRMVGGWKGFFQANCVTLNESMILELIWEED 213
                           555666777777789*******99998865..58***************778999999******************************* PP

                           E..EEEEE-S CS
                    B3  90 felvvkvfrk 99 
                           +++v+k+++k
  Bostr.27895s0015.2.p 214 TSCVLKFRSK 223
                           *9**999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100174.60E-15160No hitNo description
Gene3DG3DSA:2.40.330.103.8E-14161IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086315.679164IPR003340B3 DNA binding domain
SMARTSM010198.8E-4164IPR003340B3 DNA binding domain
SuperFamilySSF1019362.55E-14167IPR015300DNA-binding pseudobarrel domain
PfamPF023624.8E-15160IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.6E-18118223IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.73E-18120222IPR015300DNA-binding pseudobarrel domain
CDDcd100177.48E-12125221No hitNo description
PROSITE profilePS5086311.97126223IPR003340B3 DNA binding domain
SMARTSM010194.7E-22126224IPR003340B3 DNA binding domain
PfamPF023621.6E-15126223IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MILMNEKGRS WTLDLKQKKS CGTSYIRRGW RSFCHANGLR AGSIITFKLI KEGGSLVLRL  60
TPNEAKKEEE EEECSEANEV ESLSTDQESD EESSHDEKIS QECSRRKEKK HRLMWNASSS  120
PSENRFVTLT LKPYSILCSV MRLPVPFTRI NGINKETKMT LLDKHGMKWS TKLHLEDDKS  180
KRLRMVGGWK GFFQANCVTL NESMILELIW EEDTSCVLKF RSKSSIPDQR RTTYRLGSIE  240
RIFGKEK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010472473.11e-115PREDICTED: B3 domain-containing protein REM14-like
SwissprotQ8GYM41e-112REM14_ARATH; B3 domain-containing protein REM14
TrEMBLD7LIB21e-108D7LIB2_ARALL; Transcriptional factor B3 family protein
STRINGAT2G24645.11e-110(Arabidopsis thaliana)
STRINGfgenesh2_kg.4__385__AT2G24650.11e-107(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24645.17e-90B3 family protein