PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.26959s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family TCP
Protein Properties Length: 365aa    MW: 41351.4 Da    PI: 8.2196
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.26959s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP134.11.3e-411102372133
                   TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgka 90 
                           a+k+drhski+T++g+RdRR+Rls+++a+rfFdLqd+LGfdk+sktieWL+ ++k++ik+l ++ + s+      +++ +a+  +++k 
  Bostr.26959s0002.1.p 110 AKKRDRHSKICTAQGPRDRRMRLSLQIARRFFDLQDMLGFDKASKTIEWLFSKSKASIKQLKESVAASE--GGGYDEHLQAN--EKAKD 194
                           78**************************************************************44444..32222223322..22233 PP

                   TCP  91 aksaakskksqksaasalnlakesrakarararertrekmrik 133
                           +  + k +k+ +++ + + ++kesr++ar+rarert  k +++
  Bostr.26959s0002.1.p 195 EILKVKVSKRITKTMESSCKMKESRERARKRARERTMTKIKMR 237
                           3334455555556666677888****************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.9E-35111236IPR005333Transcription factor, TCP
PROSITE profilePS5136936.3112170IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137010.384216233IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MFPSLDTNGY DLFDPFRPHQ TTMLPSFTTH IQSPSSHHHF PSPSFPFSPD FLDNVDESFL  60
LSQFLLQQQD AAANVVESPR KVCKKLEQKK KNEKCVEDTT SEKDPRRRTA KKRDRHSKIC  120
TAQGPRDRRM RLSLQIARRF FDLQDMLGFD KASKTIEWLF SKSKASIKQL KESVAASEGG  180
GYDEHLQANE KAKDEILKVK VSKRITKTME SSCKMKESRE RARKRARERT MTKIKMRLSG  240
VLIDTSETIS DPHQATREIK ITNGAQVLEG ENQEQEWSTN VNMVEYQMDS VRIIEKFLGI  300
TSDSSSFSLF GDSEESNTSL SSIRGTTSTA GIVTPSEHNT ASIASVDEET NPTSSFSLYD  360
YLCY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1218228RERARKRARER
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that prevents axillary bud outgrowth. May also delay early axillary bud development. Probably involved in the auxin-induced control of apical dominance. {ECO:0000269|PubMed:17307924}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.26959s0002.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed transiently after shoot apical meristem (SAM) decapitation (release from apical dominance). {ECO:0000269|PubMed:17307924}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0119140.0AC011914.9 Arabidopsis thaliana chromosome 1 BAC F14K14 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010511900.10.0PREDICTED: transcription factor TCP12-like
SwissprotA0AQW41e-180TCP12_ARATH; Transcription factor TCP12
TrEMBLR0IEY80.0R0IEY8_9BRAS; Uncharacterized protein (Fragment)
STRINGBostr.26959s0002.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116322533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.11e-147TCP domain protein 12