PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.26833s0978.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family Nin-like
Protein Properties Length: 231aa    MW: 26968.6 Da    PI: 7.0331
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.26833s0978.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.12.7e-26119169252
                RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                           ++++++++++++F+ pi +AAkeL+v+lTvLK++CR++GI RWPhRk+ksl
  Bostr.26833s0978.1.p 119 QDKLEMSEIRQFFDRPIMKAAKELNVGLTVLKKRCRELGIYRWPHRKLKSL 169
                           6799*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.11105190IPR003035RWP-RK domain
PfamPF020421.0E-21122169IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MDHNSLPQLD YPKIENQYDP DSLYDMLEKL PPLESLLDTE DLKPNGGLHF QFQYNSFEDF  60
FDNIEVNNII GSDIHMLTQE PYISSGSSSP CAVQNDSFSS NERCEKRTVK KRNVKKKRQD  120
KLEMSEIRQF FDRPIMKAAK ELNVGLTVLK KRCRELGIYR WPHRKLKSLN SLIKNLQSVG  180
MEEEVKNLEE HRVLIEQEPD AELTDGTKKL RQACFKANYK RRKSLADDYY *
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.26833s0978.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002865951.21e-142protein RKD4
SwissprotQ9LVU81e-126RKD4_ARATH; Protein RKD4
TrEMBLD7MSC71e-141D7MSC7_ARALL; RWP-RK domain-containing protein
STRINGBostr.26833s0978.1.p1e-171(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM125852230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.11e-117RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Azpeitia E,Davila-Velderrain J,Villarreal C,Alvarez-Buylla ER
    Gene regulatory network models for floral organ determination.
    Methods Mol. Biol., 2014. 1110: p. 441-69
    [PMID:24395275]