PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.26833s0050.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LFY
Protein Properties Length: 423aa    MW: 46713.3 Da    PI: 6.9386
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.26833s0050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY6167.1e-18813921386
               FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddl 89 
                           mdpe f++ lf+w+p+ a++++p  + +  +++  p++ ++aa  ++l +le lf ayG+r++t+akiaelGft+stLv+mkdeel+++
  Bostr.26833s0050.1.p   1 MDPEGFTSGLFRWNPARAMVQAPPPVPPPPQQQ--PATPQTAAFGMRLGGLEGLFGAYGIRFYTAAKIAELGFTASTLVGMKDEELEEM 87 
                           9*************8777766665665554433..33356777788889**************************************** PP

               FLO_LFY  90 mkslseifrldllvGeryGikaavraerrrlee..eeaekkrrkll....sedeetaldalsqe....glseepvqeeke.aags.gge 166
                           m+sls+ifr++llvGeryGikaavraerrrl+e  e+++++rr+ll     + +++aldalsqe    glseepvq++ + +ag+ gg+
  Bostr.26833s0050.1.p  88 MNSLSHIFRWELLVGERYGIKAAVRAERRRLQEeeEDESSRRRHLLlsagDSGTHHALDALSQEddwtGLSEEPVQQQDQnSAGNnGGG 176
                           *******************************9855556678888777744344556*******988889******99655233331333 PP

               FLO_LFY 167 glgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeeg.....sgedgeerqrehPfivtepgevargkknGLD 250
                           g g +e+ +a+       kk++   +++rkk   ++ e+d+d +e ed+d+++     +g  g+erqrehPfivtepgevargkknGLD
  Bostr.26833s0050.1.p 177 GGGYWEAGQAK------MKKQQ---QRRRKKPMVASVETDDDVNEGEDDDGMDngnggGGVLGTERQREHPFIVTEPGEVARGKKNGLD 256
                           33344433332......22222...223333333344455555555555554411111445566************************* PP

               FLO_LFY 251 YLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqa 339
                           YLf+LyeqCrefLlqvq+iak+rGekcPtkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLde+asnalrrafkergenvG+wrqa
  Bostr.26833s0050.1.p 257 YLFHLYEQCREFLLQVQTIAKDRGEKCPTKVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEDASNALRRAFKERGENVGSWRQA 345
                           ***************************************************************************************** PP

               FLO_LFY 340 cykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                           cykplv+ia r+gwdidavfnahprLsiWYvPtkLrqLChler++a+
  Bostr.26833s0050.1.p 346 CYKPLVNIACRHGWDIDAVFNAHPRLSIWYVPTKLRQLCHLERNNAV 392
                           *******************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016984.1E-2001391IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPARAMV QAPPPVPPPP QQQPATPQTA AFGMRLGGLE GLFGAYGIRF  60
YTAAKIAELG FTASTLVGMK DEELEEMMNS LSHIFRWELL VGERYGIKAA VRAERRRLQE  120
EEEDESSRRR HLLLSAGDSG THHALDALSQ EDDWTGLSEE PVQQQDQNSA GNNGGGGGGY  180
WEAGQAKMKK QQQRRRKKPM VASVETDDDV NEGEDDDGMD NGNGGGGVLG TERQREHPFI  240
VTEPGEVARG KKNGLDYLFH LYEQCREFLL QVQTIAKDRG EKCPTKVTNQ VFRYAKKSGA  300
SYINKPKMRH YVHCYALHCL DEDASNALRR AFKERGENVG SWRQACYKPL VNIACRHGWD  360
IDAVFNAHPR LSIWYVPTKL RQLCHLERNN AVAAAAALVG GISCTGSSTS GRGGCGGDDL  420
RF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1442294221194PROTEIN LEAFY
2vy2_A1e-1442294221194PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that promotes early floral meristem identity in synergy with APETALA1. Is required subsequently for the transition of an inflorescence meristem into a floral meristem, by an immediate upstream regulation of the ABC classes of floral homeotic genes. Activates directly APETALA1, CAULIFLOWER and AGAMOUS, and indirectly APETALA3 and PISTILLATA with the cooperation of UFO. {ECO:0000269|PubMed:8565821, ECO:0000269|PubMed:9783581, ECO:0000269|Ref.6}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.26833s0050.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated by CAULIFLOWER and APETALA1. Down-regulated by TFL1.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4719320.0DQ471932.1 Brassica juncea cultivar Varuna LEAFY transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001331273.10.0floral meristem identity control protein LEAFY (LFY)
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLQ3ZLS70.0Q3ZLS7_BOEST; LEAFY protein (Fragment)
STRINGBostr.26833s0050.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Chao WS,Doğramaci M,Foley ME,Horvath DP,Anderson JV
    Selection and validation of endogenous reference genes for qRT-PCR analysis in leafy spurge (Euphorbia esula).
    PLoS ONE, 2012. 7(8): p. e42839
    [PMID:22916167]
  2. Yang C, et al.
    VAL- and AtBMI1-mediated H2Aub initiate the switch from embryonic to postgerminative growth in Arabidopsis.
    Curr. Biol., 2013. 23(14): p. 1324-9
    [PMID:23810531]
  3. Lei HJ, et al.
    Identification and characterization of FaSOC1, a homolog of SUPPRESSOR OF OVEREXPRESSION OF CONSTANS1 from strawberry.
    Gene, 2013. 531(2): p. 158-67
    [PMID:24055423]
  4. Yu Y, et al.
    MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering.
    Plant Sci., 2013. 212: p. 1-9
    [PMID:24094048]
  5. Niwa M,Endo M,Araki T
    Florigen is involved in axillary bud development at multiple stages in Arabidopsis.
    Plant Signal Behav, 2013. 8(11): p. e27167
    [PMID:24305631]
  6. Fu J, et al.
    Photoperiodic control of FT-like gene ClFT initiates flowering in Chrysanthemum lavandulifolium.
    Plant Physiol. Biochem., 2014. 74: p. 230-8
    [PMID:24316581]
  7. Risseeuw E, et al.
    An activated form of UFO alters leaf development and produces ectopic floral and inflorescence meristems.
    PLoS ONE, 2013. 8(12): p. e83807
    [PMID:24376756]
  8. Yang Z, et al.
    Analyses of sequence polymorphism and haplotype diversity of LEAFY genes revealed post-domestication selection in the Chinese elite maize inbred lines.
    Mol. Biol. Rep., 2014. 41(2): p. 1117-25
    [PMID:24381105]
  9. Chandler JW,Werr W
    Arabidopsis floral phytomer development: auxin response relative to biphasic modes of organ initiation.
    J. Exp. Bot., 2014. 65(12): p. 3097-110
    [PMID:24744428]
  10. Yamaguchi N, et al.
    Gibberellin acts positively then negatively to control onset of flower formation in Arabidopsis.
    Science, 2014. 344(6184): p. 638-41
    [PMID:24812402]
  11. Leal Valentim F, et al.
    A quantitative and dynamic model of the Arabidopsis flowering time gene regulatory network.
    PLoS ONE, 2015. 10(2): p. e0116973
    [PMID:25719734]
  12. Chen Z, et al.
    Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar.
    Transgenic Res., 2015. 24(4): p. 705-15
    [PMID:25820621]
  13. Müller-Xing R,Schubert D,Goodrich J
    Non-inductive conditions expose the cryptic bract of flower phytomeres in Arabidopsis thaliana.
    Plant Signal Behav, 2015. 10(4): p. e1010868
    [PMID:25924005]
  14. Ma X, et al.
    CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana.
    Plant Mol. Biol., 2015. 88(3): p. 287-99
    [PMID:25948280]
  15. Wang C,Dehesh K
    From retrograde signaling to flowering time.
    Plant Signal Behav, 2015. 10(6): p. e1022012
    [PMID:26098376]
  16. Kusters E,Della Pina S,Castel R,Souer E,Koes R
    Changes in cis-regulatory elements of a key floral regulator are associated with divergence of inflorescence architectures.
    Development, 2015. 142(16): p. 2822-31
    [PMID:26220938]
  17. Andrés F, et al.
    Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE.
    Plant Physiol., 2015. 169(3): p. 2187-99
    [PMID:26417007]
  18. Yamaguchi N,Jeong CW,Nole-Wilson S,Krizek BA,Wagner D
    AINTEGUMENTA and AINTEGUMENTA-LIKE6/PLETHORA3 Induce LEAFY Expression in Response to Auxin to Promote the Onset of Flower Formation in Arabidopsis.
    Plant Physiol., 2016. 170(1): p. 283-93
    [PMID:26537561]
  19. Yu Y, et al.
    WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana.
    Plant J., 2016. 85(1): p. 96-106
    [PMID:26643131]
  20. Fu X, et al.
    CHD3 chromatin-remodeling factor PICKLE regulates floral transition partially via modulating LEAFY expression at the chromatin level in Arabidopsis.
    Sci China Life Sci, 2016. 59(5): p. 516-28
    [PMID:27056257]
  21. Yamaguchi N,Wu MF,Winter CM,Wagner D
    LEAFY and Polar Auxin Transport Coordinately Regulate Arabidopsis Flower Development.
    Plants (Basel), 2014. 3(2): p. 251-65
    [PMID:27135503]
  22. Xu C,Yu Y,Zhang Y,Li Y,Wei S
    Gibberellins are involved in effect of near-null magnetic field on Arabidopsis flowering.
    Bioelectromagnetics, 2017. 38(1): p. 1-10
    [PMID:27598690]
  23. Tang M, et al.
    An ortholog of LEAFY in Jatropha curcas regulates flowering time and floral organ development.
    Sci Rep, 2016. 6: p. 37306
    [PMID:27869146]
  24. Wendell M, et al.
    Thermoperiodic Control of Floral Induction Involves Modulation of the Diurnal FLOWERING LOCUS T Expression Pattern.
    Plant Cell Physiol., 2017. 58(3): p. 466-477
    [PMID:28028164]
  25. Monniaux M, et al.
    Conservation vs divergence in LEAFY and APETALA1 functions between Arabidopsis thaliana and Cardamine hirsuta.
    New Phytol., 2017. 216(2): p. 549-561
    [PMID:28098947]
  26. Guo WY,Cui YM,Wang TT,Yu DY,Huang F
    Functional analysis of flower development related gene GsLFY from Glycine soja.
    Yi Chuan, 2017. 39(1): p. 56-65
    [PMID:28115306]
  27. Dhakate P,Tyagi S,Singh A,Singh A
    Functional characterization of a novel Brassica LEAFY homolog from Indian mustard: Expression pattern and gain-of-function studies.
    Plant Sci., 2017. 258: p. 29-44
    [PMID:28330561]
  28. Yang T,Du MF,Guo YH,Liu X
    Two LEAFY homologs ILFY1 and ILFY2 control reproductive and vegetative developments in Isoetes L.
    Sci Rep, 2017. 7(1): p. 225
    [PMID:28331204]
  29. Goslin K, et al.
    Transcription Factor Interplay between LEAFY and APETALA1/CAULIFLOWER during Floral Initiation.
    Plant Physiol., 2017. 174(2): p. 1097-1109
    [PMID:28385730]
  30. Serrano-Mislata A, et al.
    Regulatory interplay between LEAFY, APETALA1/CAULIFLOWER and TERMINAL FLOWER1: New insights into an old relationship.
    Plant Signal Behav, 2017. 12(10): p. e1370164
    [PMID:28873010]
  31. Zhang GZ, et al.
    Ectopic expression of UGT84A2 delayed flowering by indole-3-butyric acid-mediated transcriptional repression of ARF6 and ARF8 genes in Arabidopsis.
    Plant Cell Rep., 2017. 36(12): p. 1995-2006
    [PMID:29027578]
  32. Zhao W, et al.
    CsLFY is required for shoot meristem maintenance via interaction with WUSCHEL in cucumber (Cucumis sativus).
    New Phytol., 2018. 218(1): p. 344-356
    [PMID:29274285]
  33. Dotto M,Gómez MS,Soto MS,Casati P
    UV-B radiation delays flowering time through changes in the PRC2 complex activity and miR156 levels in Arabidopsis thaliana.
    Plant Cell Environ., 2018. 41(6): p. 1394-1406
    [PMID:29447428]
  34. Kumar A,Singh A,Panigrahy M,Sahoo PK,Panigrahi KCS
    Carbon nanoparticles influence photomorphogenesis and flowering time in Arabidopsis thaliana.
    Plant Cell Rep., 2018. 37(6): p. 901-912
    [PMID:29541883]