PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.26675s0358.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 282aa    MW: 31659.3 Da    PI: 5.9512
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.26675s0358.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_157.14e-18197258263
                           XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                           ++ +r++r++kNRe+A rsR+RK+a++ eLe+ +++L++eN++L ke+ee +ke +k  +ev
  Bostr.26675s0358.1.p 197 AAAQRQKRMIKNRESAARSRERKQAYQVELETLAAKLQEENEQLLKEIEESTKERYKKLMEV 258
                           5789***************************************************9988875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1709.1E-14195251No hitNo description
SMARTSM003381.7E-14196260IPR004827Basic-leucine zipper domain
PfamPF001702.7E-17197258IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.185198250IPR004827Basic-leucine zipper domain
CDDcd147072.34E-18200246No hitNo description
SuperFamilySSF579591.94E-10200252No hitNo description
PROSITE patternPS000360203218IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MASFKMMSSS NSDLSRRNSS SASSSPSIRS SHHLRPNLHA DHSRTSFAYG GGNDYTFASD  60
SKPLEMAIDV DRSIGDRNSV NNGKSVDDVW KEIVSGEQKT IMMKEEAHED VIMTLEDFLA  120
KAAMDDDDAA NIDSDEIDVK IPPERLLNND GSYTFDYPIM SQPQRHSSFQ MIEGSMGGGG  180
GMRGKRGRVM MEAMDKAAAQ RQKRMIKNRE SAARSRERKQ AYQVELETLA AKLQEENEQL  240
LKEIEESTKE RYKKLMEVLI PVDEKPRPSS RSLSRSHSLE W*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0030270.0AC003027.1 Arabidopsis thaliana chromosome I BAC F21M11 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankBT0244950.0BT024495.1 Arabidopsis thaliana At1g03970 mRNA, complete cds.
GenBankAY0876030.0AY087603.1 Arabidopsis thaliana clone 36980 mRNA, complete sequence.
GenBankU018230.0U01823.1 Arabidopsis thaliana Columbia bZIP protein GBF4 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010475032.11e-161PREDICTED: G-box-binding factor 4-like
SwissprotP427771e-159GBF4_ARATH; G-box-binding factor 4
TrEMBLQ2HIT61e-157Q2HIT6_ARATH; At1g03970
STRINGAT1G03970.11e-157(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.12e-99G-box binding factor 4