PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.25993s0430.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family Nin-like
Protein Properties Length: 930aa    MW: 102800 Da    PI: 5.1674
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.25993s0430.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.52.7e-28587637252
                RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                           ek++sl+ l+++Fs+++kdAAk+Lgvc+T+LKriCRq+GI+RWP+Rki+++
  Bostr.25993s0430.1.p 587 EKNVSLSILQQHFSGSLKDAAKSLGVCPTTLKRICRQHGIMRWPSRKINKV 637
                           89***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.699576657IPR003035RWP-RK domain
PfamPF020422.6E-27589637IPR003035RWP-RK domain
SuperFamilySSF542777.52E-23822918No hitNo description
Gene3DG3DSA:3.10.20.2409.7E-23831912No hitNo description
SMARTSM006667.2E-25833915IPR000270PB1 domain
PROSITE profilePS5174522.109833915IPR000270PB1 domain
CDDcd064073.30E-38834914No hitNo description
PfamPF005647.3E-18836914IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 930 aa     Download sequence    Send to blast
MENPFASREK GFGYQDIPTE QMDVLNTSFG SGVRNLISDD MLNSSSELMN FDSFAAWCNS  60
PSATDILFAQ YGLSNSQPMP FGAFTSFHAA EPKGTSLTRS FHDLESSYFS EERSSVQEMS  120
SQLHHSLDND ELSGKRRRVN NQKIGFPNVL NCTIPRSLSH SLDEKMLKAL SLFMESSGSG  180
EGILAQVWTP VKTGDQYVLS TCDQAYLLDP RLSQYREVSR KFTFATEANQ CSFPGLPGRV  240
FISGVPEWTS NVMYYKTDEY LRMKHAIDNE VRGSIAIPVL ETSGTSCCAV MEFVTSKEKP  300
NFDMEMDSVC RALQAVNLRT SAIPRPQYLS SNQRDALAEI QDVLRAVCHA HKLPLALAWI  360
PCRKDQSIRV SGPNSGENCV LCIEEAACYV NDMEMEGFVH ACLEHFLRER EGIVGKAFIS  420
NEPFFSSDVK AYDISEYPLV QHARKYGLNA AVAIKLRSTY TGEDDYILEL FLPVSMQGSL  480
EQQLLLDSLS GTMQRICRTL RTVSEVRSTK KEVTKPGFWS GEMSNFPQTT CSANFQTTSL  540
DSEYNSTGSI FSGMSSDKDN GITVSQGTLE QDMSKARTPE KKKSTTEKNV SLSILQQHFS  600
GSLKDAAKSL GVCPTTLKRI CRQHGIMRWP SRKINKVNRS LRKIQTVLDS VQGVEGGLKF  660
DSSTGEFIAV GPIIQEFDTQ KGLSSHGSDA HARRSQEDMT DDTSFELPEA KSVDNAVKLE  720
EDITMNQARP GSFMEVNASE QPWAWMAEQS SLNGSEGIKS VCNLSSLAIS DGMDPTIQCS  780
GSIVEPNQSM TSSISDSSNG SGAVIRGSSS TSVEDWNQMR THNNNSGESG STTLIVKATY  840
REDTVRFKFK PSVGCPQLYK EVGKRFKLQD GSFQLKYLDD EEEWVMLVTD SDLQECLEIL  900
YGMGKHSVKF LVRDLPPAIG SSAGSNGYL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134138KRRRV
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.25993s0430.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0023350.0AC002335.3 Arabidopsis thaliana chromosome 2 clone T1O24 map CIC10F02, complete sequence.
GenBankAY1025620.0AY102562.1 Arabidopsis thaliana hypothetical protein (At2g43500/T1O24.24) mRNA, complete cds.
GenBankAY1025630.0AY102563.1 Arabidopsis thaliana hypothetical protein (At2g43500/T1O24.24) mRNA, complete cds.
GenBankAY6492510.0AY649251.1 Arabidopsis thaliana hypothetical protein (At2g43500) gene, complete cds.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023639704.10.0protein NLP8 isoform X1
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLR0FUG60.0R0FUG6_9BRAS; Uncharacterized protein
STRINGBostr.25993s0430.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22992768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein
Publications ? help Back to Top
  1. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]