PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.2570s0083.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family M-type_MADS
Protein Properties Length: 227aa    MW: 26581.3 Da    PI: 8.7239
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.2570s0083.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.23.7e-171050242
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                          i+n+s r+ tf kR +g+ KK +ELSvLC++e++ +i+s+
  Bostr.2570s0083.1.p 10 YIDNDSMRKATFNKRNKGLVKKIHELSVLCGIEACAVIYSP 50
                         59**************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.62E-24185IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.563149IPR002100Transcription factor, MADS-box
SMARTSM004326.3E-23160IPR002100Transcription factor, MADS-box
CDDcd002661.27E-32285No hitNo description
PRINTSPR004042.1E-10323IPR002100Transcription factor, MADS-box
PfamPF003192.5E-161151IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MTRKKLNLSY IDNDSMRKAT FNKRNKGLVK KIHELSVLCG IEACAVIYSP FNSNPEVWPS  60
NLGVKNVVEK FEMLTEMEQE KKMVNHEGFL KQNISKAVEN NNKKMKDNAE RTMKEAMFQL  120
LRGEKLKLTN KNREDLCKYI DQYLKELHHH KNETLKQFHE ATNVMAPTSI VEVMINPVGV  180
YDQNPNFNHR SHNHYQYQQQ YGYPIMPQDG IYNASQNQDQ QEEWLV*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.2570s0083.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB8307060.0AB830706.1 Turritis glabra AGL45 gene for agamous-like MADS-box protein AGL45, partial cds, isolate: e074.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020889035.11e-125agamous-like MADS-box protein AGL80 isoform X1
SwissprotQ9FJK37e-48AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLF4J9K31e-118F4J9K3_ARATH; MADS-box transcription factor family protein
STRINGBostr.2570s0083.1.p1e-169(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.11e-120M-type_MADS family protein
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]