PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.2570s0082.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family M-type_MADS
Protein Properties Length: 270aa    MW: 30966.9 Da    PI: 9.131
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.2570s0082.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.47.7e-181150342
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                         i+n+s r+ tf kR++g++KK +ELS+LC+++++ ii+s+
  Bostr.2570s0082.1.p 11 ISNDSSRKATFKKRKKGLMKKVNELSTLCGINACAIIYSP 50
                         9**************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.367149IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-25160IPR002100Transcription factor, MADS-box
CDDcd002661.29E-23285No hitNo description
SuperFamilySSF554551.7E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-9323IPR002100Transcription factor, MADS-box
PfamPF003193.6E-181151IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-92338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MTRKKVKLAY ISNDSSRKAT FKKRKKGLMK KVNELSTLCG INACAIIYSP YDSNPEVWPS  60
NSDIQRIVSE FRTLPETDQH KKMVDQETYL RQRIAKASEH LKRQRKDNRE LEMTEVMFQC  120
LVGNMGMFHM NIMDLNDLGY LAEQYLKDIN RRFEILQNSG MEIGESSMAV MASTTAPTST  180
TNEAGSSSSF AAFVNPLQQQ QQLHHHQQFR HPSSPHIMHQ HNNNHHDHHQ PQHQYQRILG  240
DFSTVSAVDS SSCTISVTNP NLTNNTWFR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAYISNDSSRKATFKKRK
22125KKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.2570s0082.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010466902.11e-130PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK31e-112AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLR0G6N61e-110R0G6N6_9BRAS; Uncharacterized protein
STRINGBostr.2570s0082.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.11e-112AGAMOUS-like 80
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]