PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.25542s0069.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 557aa    MW: 61241.7 Da    PI: 7.1886
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.25542s0069.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.91.2e-09409465561
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                           kr +r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  +  l++
  Bostr.25542s0069.1.p 409 KRVKRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQLTLLQRDMIGLTN 465
                           899*****************************************9999877655555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.8E-19405469IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.68407470IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.9E-11409466No hitNo description
SuperFamilySSF579591.85E-11409465No hitNo description
PfamPF001701.5E-8409460IPR004827Basic-leucine zipper domain
CDDcd147031.44E-23410459No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MGDTEKCNTD MIQRLHSSFG TSSSSIPKNP IQQQQKLDLN PNFIRSSPQS PQFSKPFTDS  60
GKRIGVPPSH PNLIPPTSPY SQIPTTRQPG SLNFNPGATH SRSMSQPTSF FSFDSLPPLS  120
PSPFRDSLSP QPDHDVSMED RDSGAFTSNA SLPPSPFTRC NSTSSSSLRV GETLPPRKSH  180
RRSNSDIPSG FNSMIVQNSL PPRPLERSIS GADWSNSTPF VKKESSCERE GVGEREAMDD  240
LFSAYMNLEN IDVLNSSEAD DSKNGNEIRD DMESSRASGT KTNGSDTEGE SSSVNESANN  300
NNNLNSSGEK RESVKRRAAG GDIAPTSRHY RSVSVDSCFM EKLSFGDESL KPPPSPGTMS  360
RKVSPTNSVD GNSGAAFSIE FKNGEFTAAE MKKIMTNDKL AEMAMSDPKR VKRILANRQS  420
AARSKERKMR YIVELEHKVQ TLQTEATTLS AQLTLLQRDM IGLTNQNNEL KFRLQAMEQQ  480
ARLRDALNEA LNGEVQRLKL AIGETSNNES DRSKMQSLNA EMFQQLNISQ LRQQPQQSQQ  540
NQNGTMALAT KPESNE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1504350.0AY150435.1 Arabidopsis thaliana unknown protein (At4g38900) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283456.10.0hypothetical protein CARUB_v10004500mg
TrEMBLR0GHR20.0R0GHR2_9BRAS; Uncharacterized protein
STRINGAT4G38900.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.30.0bZIP family protein