PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.25219s0353.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 428aa    MW: 47539.4 Da    PI: 6.2977
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.25219s0353.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.86.4e-10212268561
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                           kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l  
  Bostr.25219s0353.1.p 212 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLSV 268
                           9*******************************************9999877666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.5E-15208272IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.749210273IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-10212266No hitNo description
SuperFamilySSF579598.75E-11212263No hitNo description
PfamPF001701.1E-8212264IPR004827Basic-leucine zipper domain
CDDcd147032.82E-24213262No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MDKEKSPAPP SGGLPPPSGR YSTFSPNGSS FAVKAESSFP HLTPAGSSSS DANRFSHDIS  60
RMPDNPPKNL GHRRAHSEIL TLPDDLSFDS DLGVVGAAAD GPTFSDDTDE DLMYMYLDMD  120
KFNSSATSTS QMGEPSEPAW RNELGSTSNL QSTPGSSSER PRIRHQHSQS MDGSTTIKPE  180
MLMSGNEDVS GVDSKKAISA AKLSELALID PKRAKRIWAN RQSAARSKER KMRYIAELER  240
KVQTLQTEAT SLSAQLTLLQ RDTNGLSVEN NELKLRVQTM EQQVHLQDAL NDALKEEVQH  300
LKVLTGQGTS NGASMMNYGS FGPNQQFYPN IQSMHTISAA QQFQQLQIQS QKQQQQQQQQ  360
QQQQQQHQQQ QFQFQQQQLY HLQQQQQQRL QQQEQQSGAS ELRRPIPYPG QKESVASPDL  420
EAPSTKD*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0289650.0BT028965.1 Arabidopsis thaliana At1g06070 mRNA, complete cds.
GenBankAK2296660.0AK229666.1 Arabidopsis thaliana mRNA for bZip transcription factor AtbZip69, complete cds, clone: RAFL19-85-B03.
GenBankAJ4198540.0AJ419854.1 Arabidopsis thaliana mRNA for AtbZIP transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006307367.10.0hypothetical protein CARUB_v10008993mg
SwissprotQ040880.0POF21_ARATH; Probable transcription factor PosF21
TrEMBLR0INM30.0R0INM3_9BRAS; Uncharacterized protein
STRINGscaffold_100594.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.10.0bZIP family protein