PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.25219s0329.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 207aa    MW: 23486.2 Da    PI: 9.8968
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.25219s0329.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.31.5e-3424115192
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           aCa+Ck++r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k++++++ee+r+++ +sl++eA +r++dPv G++g ++++ ++l+ 
  Bostr.25219s0329.2.p  24 ACASCKHQRKKCNNECILSPYFPARKTKEFQAVHKVFGVSNVQKMVRTVREEDRTKLSDSLTWEALWRQKDPVLGSYGEYRRICEELKL 112
                           7***********************************************************************************99998 PP

                DUF260  90 lka 92 
                            k+
  Bostr.25219s0329.2.p 113 YKS 115
                           775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.26423123IPR004883Lateral organ boundaries, LOB
PfamPF031958.5E-3224114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MMQRNSNTTT TNNNISNNSS SHQACASCKH QRKKCNNECI LSPYFPARKT KEFQAVHKVF  60
GVSNVQKMVR TVREEDRTKL SDSLTWEALW RQKDPVLGSY GEYRRICEEL KLYKSLVHNQ  120
PLLGWDNNQR VFNNNNNNNN KNGLLMNSSG SGGFSVNNNG VGVNAEIVNG GYTSRNLQGG  180
WENLKHDQRQ QCYAVINGFK QHYLPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-18251011288LOB family transfactor Ramosa2.1
5ly0_B8e-18251011288LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.25219s0329.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738650.0AB473865.1 Arabidopsis thaliana ASL32 mRNA for ASYMMETRIC LEAVES2-like 32 protein, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF9P140.0AC025290.3 Sequence of BAC F9P14 from Arabidopsis thaliana chromosome 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002892332.11e-127LOB domain-containing protein 2
RefseqXP_020869821.11e-127LOB domain-containing protein 2
SwissprotQ9LNB91e-124LBD2_ARATH; LOB domain-containing protein 2
TrEMBLD7KG181e-125D7KG18_ARALL; Uncharacterized protein
STRINGBostr.25219s0329.1.p1e-151(Boechera stricta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.12e-96LOB domain-containing protein 2