PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.25219s0329.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 231aa    MW: 26434.9 Da    PI: 9.5786
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.25219s0329.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260109.91.9e-3448139192
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           aCa+Ck++r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k++++++ee+r+++ +sl++eA +r++dPv G++g ++++ ++l+ 
  Bostr.25219s0329.1.p  48 ACASCKHQRKKCNNECILSPYFPARKTKEFQAVHKVFGVSNVQKMVRTVREEDRTKLSDSLTWEALWRQKDPVLGSYGEYRRICEELKL 136
                           7***********************************************************************************99998 PP

                DUF260  90 lka 92 
                            k+
  Bostr.25219s0329.1.p 137 YKS 139
                           775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.26447147IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-3148138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MFKLLLFCDI RFLLFPCQLL IYTDMMQRNS NTTTTNNNIS NNSSSHQACA SCKHQRKKCN  60
NECILSPYFP ARKTKEFQAV HKVFGVSNVQ KMVRTVREED RTKLSDSLTW EALWRQKDPV  120
LGSYGEYRRI CEELKLYKSL VHNQPLLGWD NNQRVFNNNN NNNNKNGLLM NSSGSGGFSV  180
NNNGVGVNAE IVNGGYTSRN LQGGWENLKH DQRQQCYAVI NGFKQHYLPL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-1740125388LOB family transfactor Ramosa2.1
5ly0_B2e-1740125388LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.25219s0329.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF9P140.0AC025290.3 Sequence of BAC F9P14 from Arabidopsis thaliana chromosome 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002892332.11e-126LOB domain-containing protein 2
RefseqXP_020869821.11e-126LOB domain-containing protein 2
SwissprotQ9LNB91e-123LBD2_ARATH; LOB domain-containing protein 2
TrEMBLD7KG181e-124D7KG18_ARALL; Uncharacterized protein
STRINGBostr.25219s0329.1.p1e-172(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.12e-96LOB domain-containing protein 2