PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.25219s0157.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 188aa    MW: 20976.9 Da    PI: 4.6758
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.25219s0157.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.72e-4332130199
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r+da++s+vyeAear+rdPvyG++g i +lq+q+++
  Bostr.25219s0157.1.p  32 PCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHRVFGASNIIKFLQELPESQRTDAVKSMVYEAEARIRDPVYGCAGAIYHLQRQVSE 120
                           7**************************************************************************************** PP

                DUF260  90 lkaelallke 99 
                           l+a+la+++ 
  Bostr.25219s0157.1.p 121 LQAQLAKAQV 130
                           ******9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.29431132IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-4332129IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MESNGDASAA TTPVISSCSP VPPLLPRVVL SPCAACKILR RRCAEKCVLA PYFPPTDPAK  60
FTIAHRVFGA SNIIKFLQEL PESQRTDAVK SMVYEAEARI RDPVYGCAGA IYHLQRQVSE  120
LQAQLAKAQV EMVNMEFQKS NLLDLIYNMD QQNQEQDNMS FESNDLGFLE DNSNTNSSML  180
WWDPLWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-423113410113LOB family transfactor Ramosa2.1
5ly0_B2e-423113410113LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.25219s0157.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738410.0AB473841.1 Arabidopsis thaliana ASL8 mRNA for ASYMMETRIC LEAVES2-like 8 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172268.11e-115LOB domain-containing protein 1
SwissprotQ9LQR01e-116LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A178WM561e-114A0A178WM56_ARATH; LBD1
STRINGBostr.25219s0157.1.p1e-138(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-103LOB domain-containing protein 1