PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.25219s0149.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family NF-YC
Protein Properties Length: 207aa    MW: 23082 Da    PI: 9.9542
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.25219s0149.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC461.1e-141011881299
                 NF-YC  12 katdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                            ++d k  ++P+ ri++i+++d+   +i  +a  l+ ka e+fi  ++  ++  + + k++ ++   ++++v + + ++fl d vp++
  Bostr.25219s0149.1.p 101 GVEDAKMFRFPMNRIRRIMRSDNSAPQIMQDAVFLVNKATEMFIERFSEEAYESSVKDKKKFIHYKHLSSVVGNDERYKFLADCVPEK 188
                           57899999*****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.1E-19108187IPR009072Histone-fold
PfamPF008081.1E-21109172IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.103.5E-23110187IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MVSSKKPKEK KARSDGVNKT GSRSTRSSGS KTKKTPNKVS IVKKEPEIYE ISESSSSDSV  60
EEAIRGDEPQ KSNGVVSKGR NGKGGGFPTK TSKNREEDDG GVEDAKMFRF PMNRIRRIMR  120
SDNSAPQIMQ DAVFLVNKAT EMFIERFSEE AYESSVKDKK KFIHYKHLSS VVGNDERYKF  180
LADCVPEKLK AEVALEEWER GMTDAG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0252660.0BT025266.1 Arabidopsis thaliana At1g07980 mRNA, complete cds.
GenBankAY0868150.0AY086815.1 Arabidopsis thaliana clone 28026 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010458017.11e-112PREDICTED: uncharacterized protein LOC104739381
TrEMBLQ0WP191e-115Q0WP19_ARATH; Putative uncharacterized protein At1g07980
STRINGfgenesh1_pg.C_scaffold_10006501e-106(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.11e-97nuclear factor Y, subunit C10