PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.24513s0205.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 272aa    MW: 29414.2 Da    PI: 8.7824
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.24513s0205.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.23.1e-3952150199
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++ e++r da++slvyeA+ r+rdP+yG++g i++lq+++++
  Bostr.24513s0205.1.p  52 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLLEVGESQRGDAANSLVYEANLRLRDPIYGCMGAISALQHHIQS 140
                           7**************************************************************************************** PP

                DUF260  90 lkaelallke 99 
                           l++el ++++
  Bostr.24513s0205.1.p 141 LQSELTTVRT 150
                           *****99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.06751152IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-4052149IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MSRDREGFGE YYKIVKKIKK DPTFETTTDH AVMGIRRHVA VPPGTTLNTV TPCAACKLLR  60
RRCAEECPFS PYFSPHEPHK FAAVHKVFGA SNVSKMLLEV GESQRGDAAN SLVYEANLRL  120
RDPIYGCMGA ISALQHHIQS LQSELTTVRT DILRHKYREA TTITSLQNNN FNNTTTTSSV  180
SCDHHALASA ILLPPPPPPP PPPPPRPPRL LSSQPAPPPT PPASLPSPSM VVSSSSSSNS  240
SATNSMYNPP PSSAAGYSNS LSSDNNVHYF D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-40451634122LOB family transfactor Ramosa2.1
5ly0_B3e-40451634122LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.24513s0205.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738430.0AB473843.1 Arabidopsis thaliana ASL10 mRNA for ASYMMETRIC LEAVES2-like 10 protein, complete cds.
GenBankAF4478880.0AF447888.1 Arabidopsis thaliana LOB DOMAIN 13 (LBD13) mRNA, complete cds.
GenBankBT0260520.0BT026052.1 Arabidopsis thaliana At2g30340 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018433132.11e-147PREDICTED: LOW QUALITY PROTEIN: LOB domain-containing protein 13
SwissprotQ9AT611e-141LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A178VTE11e-139A0A178VTE1_ARATH; LBD13
STRINGBostr.24513s0205.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.11e-118LOB domain-containing protein 13
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]