PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.24513s0082.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 386aa    MW: 43225.9 Da    PI: 6.5193
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.24513s0082.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.34.5e-10200258563
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                           kr++r   NR +A rs +RK  +i eLe+k+++L++e ++L  +l  l+     l+ e+
  Bostr.24513s0082.1.p 200 KRAKRIWANRQSAARSKERKTRYIFELERKIQTLQTEATTLSAQLTLLQRDTNGLTVEN 258
                           9********************************************99998887777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.9E-14196260IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.45198261IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.3E-11200254No hitNo description
SuperFamilySSF579593.94E-10200251No hitNo description
PfamPF001703.5E-8200252IPR004827Basic-leucine zipper domain
CDDcd147031.72E-21201250No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MDKEKSPAPC GGLPPPSPSG RCSAFSDSGP SGHVSDANRM SHDISRMLDN PPKKIGHRRA  60
HSEILTLPDD LSFDSDLGVV GNAADGASFS DETEEDFLSM YLDMDKFNSS ATSSAQVGEP  120
SGTAWKNESM MHTGSTSNPQ NALNSFGERP RIRHQHSQSM DSSMNINEML MSGNEDDSAI  180
DAKKSMSATK LAELALIDPK RAKRIWANRQ SAARSKERKT RYIFELERKI QTLQTEATTL  240
SAQLTLLQRD TNGLTVENNE LKLRLQTMEQ QVHLQDELNE ALKEEIQHLK VLTGQVAPSA  300
LNYGSFGSNQ QFYSNNQSMQ TILAAKQFQQ LQIHSQKQQQ QQQQQQQQQY QFQQQQMQQL  360
MQQRIQQQEQ QNGVRLKPSQ AQKES*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1130580.0AY113058.1 Arabidopsis thaliana At2g31370/T28P16.14 mRNA, complete cds.
GenBankAY0575340.0AY057534.1 Arabidopsis thaliana At2g31370/T28P16.14 mRNA, complete cds.
GenBankAK3170870.0AK317087.1 Arabidopsis thaliana AT2G31370 mRNA, complete cds, clone: RAFL21-87-G20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002879324.10.0hypothetical protein ARALYDRAFT_482066
SwissprotQ040880.0POF21_ARATH; Probable transcription factor PosF21
TrEMBLD7LDK30.0D7LDK3_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.4__1126__AT2G31370.40.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31370.60.0bZIP family protein