PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.24145s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 215aa    MW: 24870.3 Da    PI: 7.673
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.24145s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601231.5e-38131131101
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           aCa+Ck++r+kC+k+C lapyfp+++pk+f n+hklFG+sn++k++k ++e++r++am+ l+y+A+ara dPv G ++++ +l++++e+
  Bostr.24145s0001.1.p  13 ACASCKYQRKKCTKNCLLAPYFPQDRPKQFLNAHKLFGVSNITKMIKGVEESQRDIAMQNLTYHANARALDPVGGLYRIMCDLKRKIEC 101
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkeel 101
                            +ael+l+++++
  Bostr.24145s0001.1.p 102 CHAELNLIHQQI 113
                           ********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.03812113IPR004883Lateral organ boundaries, LOB
PfamPF031955.2E-3513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MSLNTPSGGS TTACASCKYQ RKKCTKNCLL APYFPQDRPK QFLNAHKLFG VSNITKMIKG  60
VEESQRDIAM QNLTYHANAR ALDPVGGLYR IMCDLKRKIE CCHAELNLIH QQIAMCRSLA  120
QQEQRQRQRQ DLPFGCYSYG DLLEQEKEYV NVDGYDYQNM QQHQEMQQQE SPINYEMFLK  180
MPEQTSEVKL EERKISDQEQ NNLLRQILMS SSIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-2541134111LOB family transfactor Ramosa2.1
5ly0_B3e-2541134111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.24145s0001.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010416074.11e-128PREDICTED: LOB domain-containing protein 7-like
SwissprotQ9SSM97e-99LBD7_ARATH; LOB domain-containing protein 7
TrEMBLA0A087HHY61e-104A0A087HHY6_ARAAL; Uncharacterized protein
STRINGBostr.24145s0001.1.p1e-159(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM154661417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72980.12e-95LOB domain-containing protein 7