PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.23794s0501.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family TALE
Protein Properties Length: 678aa    MW: 73917.7 Da    PI: 6.8541
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.23794s0501.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-094034401954
                           HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
              Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                           Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Bostr.23794s0501.1.p 403 FEHflHPYPKDSDKHMLAKQTGLTRNQVSNWFINARVR 440
                           554459******************************88 PP

2BELL122.71.5e-39262333172
                  BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                           erqe+q+kkakL ++l+eV++rY+qy++q+q+vissFe++ag+gsak+YtslAlk+iSr+FrcLk+aia+qi
  Bostr.23794s0501.1.p 262 ERQEIQMKKAKLSNMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQI 333
                           79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.6E-82182331IPR006563POX domain
PfamPF075267.7E-47188330IPR006563POX domain
PROSITE profilePS5007112.26381444IPR001356Homeobox domain
SMARTSM003894.9E-9384448IPR001356Homeobox domain
CDDcd000863.98E-12384444No hitNo description
SuperFamilySSF466898.13E-17385451IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.2E-29387451IPR009057Homeodomain-like
PfamPF059204.0E-18401440IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MAAYFDGNPP EISAGSDGGL QTLILMNPTT YVQYTQQEDD SNNNNNNNSN SNNNRNTNTN  60
NNSFVFLNSH APPPNASQQF VGIPLSGHEA ASITAADNIS VLHGYPPRVQ YSLYGSHQVD  120
PTHQQAAGET PRAQQGLSLT LSSQQQQQQQ HHQQHQPIHV GFGSGPGEDI RVGSGSTGSG  180
VTNGIANLVS SKYLKAAQEL LDEVVNADSD DINAKSQLFS SKKGSSGNDK AVGESSAGAG  240
GEGSGGGGEA AGKRTVELGT AERQEIQMKK AKLSNMLHEV EQRYRQYHQQ MQMVISSFEQ  300
AAGIGSAKSY TSLALKTISR QFRCLKEAIA GQIKAANKSL GEEDSVSGVG RFEGSRLKFV  360
DHHLRQQRAL QQLGMIQHPS NNAWRPQRGL PERAVSVLRA WLFEHFLHPY PKDSDKHMLA  420
KQTGLTRNQV SNWFINARVR LWKPMVEEMY MEEMKEQGKN MGSMEKTPLD QSNEDSASKS  480
TSNQEKSPMA DTYHMNPNHN GDLEGVTGMQ GSPKRLRTSD DTMMHPINAD FSSNEKLTMK  540
ILEERQGIRS DGGYPFMGNF GQYQMDEMSR FDVVSDQELM AQRYSGNNNG VSLTLGLPHC  600
DSLSSTHHQG FMQTHHGIPI GRRVKIGETE EYGAAAINGG GSATTAHSSA AAAAAYNGMN  660
MQNQKRYVAQ LLPDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16390448563Homeobox protein Meis2
3k2a_B2e-16390448563Homeobox protein Meis2
4xrs_A1e-16390447158Homeobox protein Meis1
4xrs_B1e-16390447158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0084220.0BT008422.1 Arabidopsis thaliana At2g35940 gene, complete cds.
GenBankAY0998540.0AY099854.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankAY0965480.0AY096548.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankAY0721750.0AY072175.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankAK2272720.0AK227272.1 Arabidopsis thaliana mRNA for putative homeodomain transcription factor, complete cds, clone: RAFL11-09-C20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010505121.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLR0HRR20.0R0HRR2_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.4__1624__AT2G35940.30.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1