PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.23794s0246.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 72aa    MW: 8395.69 Da    PI: 8.4762
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.23794s0246.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26042.22.3e-13570166
                DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAe 66
                          +C++C +++++ ++dC++a  f +  p kf++v+ +F+ ++++ +lk+l++ +r  ++++ + eA+
  Bostr.23794s0246.1.p  5 QCEVCTFQNKQYVNDCIFASLFTSYGPYKFNVVNAIFRLETLTFFLKDLSPMQRIFTTRTFYLEAK 70
                          6************************************************************99997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.716471IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-11570IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 72 aa     Download sequence    Send to blast
MNPNQCEVCT FQNKQYVNDC IFASLFTSYG PYKFNVVNAI FRLETLTFFL KDLSPMQRIF  60
TTRTFYLEAK S*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.23794s0246.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001326100.13e-26LOB domain-containing protein 26
RefseqNP_001326101.13e-26LOB domain-containing protein 26
RefseqNP_189433.13e-26LOB domain-containing protein 26
SwissprotQ9LIJ02e-27LBD26_ARATH; LOB domain-containing protein 26
TrEMBLA0A178VCA63e-26A0A178VCA6_ARATH; LBD26
STRINGBostr.23794s0246.1.p8e-46(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2101245
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27940.19e-30LOB domain-containing protein 26