PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.23794s0013.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 226aa    MW: 24679 Da    PI: 8.5948
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.23794s0013.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.77.3e-42451441100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq++ 
  Bostr.23794s0013.1.p  45 PCAACKLLRRRCAQECPFSPYFSPHEPHKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQA 133
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+ael ++++e
  Bostr.23794s0013.1.p 134 LQAELTAVRSE 144
                           ******99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.90744145IPR004883Lateral organ boundaries, LOB
PfamPF031954.7E-4245142IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MSRERERFEE IGKKIQREAD AWPHHMAGIR RPMSGPPGTL NTITPCAACK LLRRRCAQEC  60
PFSPYFSPHE PHKFASVHKV FGASNVSKML MEVPESQRAD AANSLVYEAN VRLRDPVYGC  120
MGAISALQQQ VQALQAELTA VRSEILKYKQ REAVATLIVP SNSQVAGFHN SGGVSVIAPP  180
PQRPSTPPQP TAAHPPPPSS CVFSQPTTRA LEYGDIESEN NSYFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-44371483114LOB family transfactor Ramosa2.1
5ly0_B6e-44371483114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.23794s0013.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738440.0AB473844.1 Arabidopsis thaliana ASL11 mRNA for ASYMMETRIC LEAVES2-like 11 protein, complete cds.
GenBankBT0252880.0BT025288.1 Arabidopsis thaliana At2g40470 mRNA, complete cds.
GenBankDQ4466130.0DQ446613.1 Arabidopsis thaliana clone pENTR221-At2g40470 LOB domain protein 15/lateral organ boundaries domain protein 15 (At2g40470) mRNA, complete cds.
GenBankDQ6530510.0DQ653051.1 Arabidopsis thaliana clone 0000012791_0000009246 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010508856.11e-144PREDICTED: LOB domain-containing protein 15
RefseqXP_020882787.11e-144LOB domain-containing protein 15 isoform X2
SwissprotQ8L5T51e-135LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A087H4761e-148A0A087H476_ARAAL; Uncharacterized protein
STRINGBostr.23794s0013.1.p1e-166(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-128LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]