PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.2199s0049.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family M-type_MADS
Protein Properties Length: 320aa    MW: 36618 Da    PI: 6.9465
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.2199s0049.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF31.13e-101251443
                         -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
               SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                         en+  r   + k r g++KK + L +LCd+++++iifs++
  Bostr.2199s0049.1.p 12 ENEKSRGKKLKKLRVGLMKKVKDLTILCDVKACMIIFSPN 51
                         77777777888999************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.278151IPR002100Transcription factor, MADS-box
SMARTSM004322.6E-15160IPR002100Transcription factor, MADS-box
CDDcd002665.73E-21285No hitNo description
SuperFamilySSF554553.92E-17295IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-6323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-111151IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-62338IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-63859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MTRKKLKLAG VENEKSRGKK LKKLRVGLMK KVKDLTILCD VKACMIIFSP NEVEPVVWPS  60
AEKACDLLDG FFALPEIEKK KKDMSLELYL KEKTKKVHEQ FMKTHKKHMD YVIDQLMVRL  120
HHGHGIDDLD LSEIYALISF SRDNIILRKK ELEFVQFSPL RDPPVPQFEA QFEELKTTTN  180
DVFVRGGQVD ERAWKNDEET KRVSICNALK GNQSHYLIDK WVFTSPETLK PRNYQQIEMD  240
MVSYNKNPNP VLYQGNTSNG NPNLDIEPVG FEVKKEGSIV NSGDLQFHER SNTIAINDGI  300
RQEPPPNGTI LGECNDGED*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.2199s0049.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020889440.11e-149MADS-box protein SVP-like
TrEMBLV4NQI01e-116V4NQI0_EUTSA; Uncharacterized protein
STRINGBostr.2199s0049.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.15e-85AGAMOUS-like 48