PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.2199s0041.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 110aa    MW: 12559.8 Da    PI: 9.5982
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.2199s0041.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26066.37e-21229725100
               DUF260  25 eqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                          + + +++n+++lFG+ n++++++++pee++++++ss+++e++++a+dPv+G +g+++kl ++++  ka l++l+e+
  Bostr.2199s0041.1.p  22 KLQGEYKNANELFGTPNIIRMMRRTPEEKKHMLASSIIMEGNVWAKDPVSGGFGMMRKLMWEIKLQKAYLHELEEK 97 
                          44789*****************************************************************999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.922198IPR004883Lateral organ boundaries, LOB
PfamPF031954.7E-162194IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MEALGADVNR GRCSVCTTKN KKLQGEYKNA NELFGTPNII RMMRRTPEEK KHMLASSIIM  60
EGNVWAKDPV SGGFGMMRKL MWEIKLQKAY LHELEEKIKE VKEKTELCL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.2199s0041.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174832.12e-36LOB domain-containing protein 5
SwissprotQ9C8V81e-37LBD5_ARATH; LOB domain-containing protein 5
TrEMBLA0A178WK746e-35A0A178WK74_ARATH; LBD5
STRINGBostr.2199s0041.1.p2e-75(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122821432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G36000.11e-39LOB domain-containing protein 5