PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.20903s0063.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 329aa    MW: 36673.1 Da    PI: 6.7268
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.20903s0063.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.31e-10203246548
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                           kr +r   NR +A+rsR RK+++i eLe+ v +L++e + L  +
  Bostr.20903s0063.1.p 203 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSVLSPR 246
                           899********************************998777655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-13199263IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.588201253IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.49E-11203257No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-13203254No hitNo description
PfamPF001702.8E-9203247IPR004827Basic-leucine zipper domain
CDDcd147037.70E-24204254No hitNo description
PROSITE patternPS000360206221IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MAQLPPKIPT MMTPNWPDFS SQKLPSIAAT AAAAATAGPQ QQNPSWMDEF LDFSATRRGT  60
HRRSISDSIA FLEPPSSGVG NHHFDRFDDE QFMSMFNDDV HNNHNHHHPN NNLNGNVGAT  120
RSSSNTSTPS DHNSISDDDN KEAPPSDHDH HMDNNIANQN NAAGNNYNES DEVQSQCKTE  180
PQDGPSANQN SGGSSGNRIH DPKRVKRILA NRQSAQRSRV RKLQYISELE RSVTSLQTEV  240
SVLSPRVAFL DHQRLLLNVD NSAIKQRIAA LAQDKIFKDA HQEALKREIE RLRQVYHQQS  300
IKKMENNVSD QSPADIKPSV EKEQLLNV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0087280.0BT008728.1 Arabidopsis thaliana At3g58120 gene, complete cds.
GenBankAY0930530.0AY093053.1 Arabidopsis thaliana pelota-like protein (At3g58120) mRNA, complete cds.
GenBankAY0873560.0AY087356.1 Arabidopsis thaliana clone 34553 mRNA, complete sequence.
GenBankAF4013000.0AF401300.1 Arabidopsis thaliana transcription factor bZIP61 (BZIP61) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010427719.10.0PREDICTED: basic leucine zipper 61
SwissprotQ9M2K40.0BZP61_ARATH; Basic leucine zipper 61
TrEMBLR0HGS40.0R0HGS4_9BRAS; Uncharacterized protein
STRINGAT3G58120.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.10.0bZIP family protein