PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.20505s0068.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 302aa    MW: 32819.8 Da    PI: 9.6248
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.20505s0068.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.49.7e-16231273547
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                           +r++r++kNRe+A rsR+RK+a++ eLe kv  Le+eN++L+ 
  Bostr.20505s0068.1.p 231 RRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENERLRR 273
                           79***************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.4E-14224274No hitNo description
SMARTSM003381.7E-12227299IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.427229274IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.5E-10231276No hitNo description
CDDcd147071.38E-22231285No hitNo description
PfamPF001701.2E-12231274IPR004827Basic-leucine zipper domain
PROSITE patternPS000360234249IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MDSQRGIVEE AKSQSLNRQN SLYSLTLDEV QNHLGSSGKA LGSMNLDELL KSVCSVEANQ  60
PSSMAMNGAA AAQEGLSRQG SLTLPRDLSK KTVDEVWKDI QQNKNGGNAH ERRDKQPTLG  120
EMTLEDLLLK AGVVTETIPG SNHDGPGDPA GGGGSAGSGA GLGQNITQVG PWVQYHQLPS  180
MPQPQAFMPY PVSDMQAMVS QSSLMGGLSD TQTPGRKRVA SGEVVEKTVE RRQKRMIKNR  240
ESAARSRARK QAYTHELEIK VSRLEEENER LRRQKEVEKI LPSAPPPDPK RQLRRTSSSP  300
F*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0816700.0AY081670.1 Arabidopsis thaliana promoter-binding factor-like protein (At3g56850) mRNA, complete cds.
GenBankAY0624480.0AY062448.1 Arabidopsis thaliana promoter-binding factor-like protein (At3g56850; T8M16_180) mRNA, complete cds.
GenBankAB0171620.0AB017162.1 Arabidopsis thaliana mRNA for ABA-responsive element binding protein 3 (AREB3), complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010504594.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
RefseqXP_010516284.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
SwissprotQ9LES30.0AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLV4NE970.0V4NE97_EUTSA; Uncharacterized protein
STRINGAT3G56850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18842883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.10.0ABA-responsive element binding protein 3