Plant Transcription Factor Database
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.20129s0304.1.p
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family BES1
Protein Properties Length: 326aa    MW: 34705.5 Da    PI: 7.3048
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.20129s0304.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasas 89 
                           ++++r+ptw+ErEnnkrRERrRRaiaaki++GLR++Gny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg++p e++e++g+sa+as
                           5899************************************************************************************* PP

                DUF822  90 pesslqsslkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsss 149
                           p+ss+q        +sp++sy++sp+ss+f+sp+s+++++l+s   +sl+p+l++ls++sss
                           ******........**********************9999998788**********997776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.2E-653139IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0903310.0AY090331.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
GenBankAY0504300.0AY050430.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010417476.10.0PREDICTED: BES1/BZR1 homolog protein 4
SwissprotQ9ZV880.0BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLD7KVU20.0D7KVU2_ARALL; Putative uncharacterized protein
TrEMBLV4K8A20.0V4K8A2_EUTSA; Uncharacterized protein
STRINGAT1G78700.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-175BES1/BZR1 homolog 4