PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.20129s0287.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family STAT
Protein Properties Length: 636aa    MW: 72103.7 Da    PI: 5.5131
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.20129s0287.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT177.52e-552213401121
                  STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfei 89 
                           ldvvl+na+gqpv+kdvevvasLlyad+ l+ +k+++a apLLi+ +Gvefss d+p+kll+Gr+sfklkis Lssk+dnrLf+ikf i
  Bostr.20129s0287.2.p 221 LDVVLSNAIGQPVHKDVEVVASLLYADT-LLEAKMSEAVAPLLIRDEGVEFSSDDKPIKLLNGRSSFKLKISLLSSKSDNRLFWIKFGI 308
                           8**************************9.8999******************************************************** PP

                  STAT  90 pklkkypfleavskpirCisrsrntrsssltk 121
                           ++ k+ypfl+avs+pirCis s ++r++s+t 
  Bostr.20129s0287.2.p 309 RNAKDYPFLQAVSNPIRCISISPDVRPLSVTL 340
                           ***************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2002.8E-624146IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF498992.77E-829165IPR013320Concanavalin A-like lectin/glucanase domain
PfamPF133851.6E-630147No hitNo description
Gene3DG3DSA:3.30.505.102.0E-7570607IPR000980SH2 domain
SuperFamilySSF555501.23E-7571603IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 636 aa     Download sequence    Send to blast
MACVSAIETE KYSLLEDFNV DVEVDDKEYE TFSLCFWVYL LNSTTFPSTI IRQVHSDMSV  60
SAPFLVLDEN KKMMLLPFTL LHKEAPDPVD TSSWTQVPSV STKSEFPLEK WVHVGCEVSR  120
NYMRLFIDGK IEGEQFLTSL LTKNSNPECP RKVSLFSVGG NGYSVQGFIK CAKVLPASDH  180
VEHHYMKDPP LLLSVNKSSS SGIKLDDDGV WKASCREIFS LDVVLSNAIG QPVHKDVEVV  240
ASLLYADTLL EAKMSEAVAP LLIRDEGVEF SSDDKPIKLL NGRSSFKLKI SLLSSKSDNR  300
LFWIKFGIRN AKDYPFLQAV SNPIRCISIS PDVRPLSVTL KRLTNIDHPS STESPDLLNN  360
TSSVKRIRLD KESDSGSEES YQHCNSYPQT SRQFEDGNGM RLHEEFNSST DSENSEMRHT  420
ISDSTIFKYC LGNLTEKALL LKEITNNSSD NEVLKFANQV SLYSGCSHHS YQINMARELI  480
AEGTNAWILI SRNNQYVHWD NVVYEIEEHF MRISKCSSRS LTNQDFELLR RISGCYQYIT  540
QENFEKMWCW VFPVAYSISS GLINGMWRSS SPKWVEGFIT KEEAEHSLQG QEPGTFILRF  600
PISRSWPHPD AEIVEGTWMQ NRCKICCWLN LSSLG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2215320.0AK221532.1 Arabidopsis thaliana mRNA for Hypothetical protein, complete cds, clone: RAFL07-69-D06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002889197.10.0hypothetical protein ARALYDRAFT_477018
TrEMBLD7KVC10.0D7KVC1_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.2__2148__AT1G78540.10.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B