PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.19424s1002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 679aa    MW: 73972.2 Da    PI: 6.4686
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.19424s1002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.73.8e-11192251362
                           XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                           + kr +r ++NRe+A+ sR+RKk+++eeLe+kvk++ a   +L  ++     e a+l+++
  Bostr.19424s1002.1.p 192 DKKRLIRQIRNRESAQLSRLRKKQQTEELERKVKSMNATIAQLNGKIAYVMAENAALRQQ 251
                           679*************************************99999999999999988886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.9E-13187252No hitNo description
SMARTSM003387.5E-13189254IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.036192255IPR004827Basic-leucine zipper domain
PfamPF001701.1E-9194252IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-10194252No hitNo description
CDDcd147041.80E-15195246No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006990Biological Processpositive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response
GO:0009408Biological Processresponse to heat
GO:0005635Cellular Componentnuclear envelope
GO:0005654Cellular Componentnucleoplasm
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016020Cellular Componentmembrane
GO:0048471Cellular Componentperinuclear region of cytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MVTESTSVIV PPPEIPNLNP SMFSESDIMS IPPLDPLFLA DSDPISMDAP ISDLDFLLDD  60
ENGDFADFDF SFDNSDDFFD FDLAEPAAAV IPEENGNNRS NLNSSETRND DVGLEGLSDS  120
VHSQVSSQGS KTTFVSDTVD ALSSPESSNH QKSSVSKRKK EKEESGGEYR SCKYQKSDDK  180
SVATNNEEDD DDKKRLIRQI RNRESAQLSR LRKKQQTEEL ERKVKSMNAT IAQLNGKIAY  240
VMAENAALRQ QMTVASGAPP LNPYMAAPPL PYQWMPYPPY PVRGYGSQTP LVPIPKLNPK  300
PVSSCRPKKA ESKKNEGKSK LKKVASISFI GIIFFIFLFG TLVPFMNVNY GGEGGSFGGL  360
SKYDGHRYYD EHKGKVLMVG DGSDVRRVGG ISDGHIHSSR RIHGERDSCG GVDYNAHPKV  420
EGRPSSVSNA SDPLFASLYV PRNDGLVKID GNLIIHSVLA SEKATALAKK NITATVKSKE  480
PDLTIPGALS SALAVPEVRG NAAMLPHSTA LSSEGKRLHQ WFHEGGSGNL MDYSMCTEVF  540
QFDIAPGAIV PSSVSNISAE HLQNVTTHGK RMKNRRILEG LPISLVASEL NITGTQPNKE  600
TQNKTFNGNT NKKPTSSSSM VVSVLLDPRE IVDSETDRVV PSNPKSLSRI FVVVLLDSVK  660
YVTYSCVLPR SGLHLVTT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00345DAPTransfer from AT3G10800Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0025020.0BT002502.1 Arabidopsis thaliana putative bZIP transcription factor (At3g10800) mRNA, complete cds.
GenBankAK2269280.0AK226928.1 Arabidopsis thaliana mRNA for bZIP transcription factor AtbZip28, complete cds, clone: RAFL09-25-P21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882698.10.0bZIP transcription factor family protein
SwissprotQ9SG860.0BZP28_ARATH; bZIP transcription factor 28
TrEMBLD7L9R10.0D7L9R1_ARALL; BZIP transcription factor family protein
STRINGfgenesh2_kg.3__1116__AT3G10800.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM143971822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10800.10.0bZIP family protein