PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.19424s0967.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family B3
Protein Properties Length: 328aa    MW: 38521 Da    PI: 10.4187
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.19424s0967.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B353.35e-1719111197
                           EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                           f k++ ++d +++++  +p +f++++++ k  s +++++ ++g+sW++k+  r++++ y+ + GW +Fv++n L  ++f++F ++g++ 
  Bostr.19424s0967.1.p  19 FYKIFRSADISSENMRAFPYNFISRISE-KDFSYKMVMRAQWGKSWDMKV-SRNTRCYYIEKCGWDQFVSDNALGRNEFITFIHKGKMI 105
                           678999999999***********99964.46999****************.477777788889********************999888 PP

                           E..EEEEE CS
                    B3  90 felvvkvf 97 
                           f  +v ++
  Bostr.19424s0967.1.p 106 F--NVYIY 111
                           8..66665 PP

2B333.29.5e-112353141397
                           TT-EE--HHH.HTT---..--SEEEEEETTS.-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                    B3  13 sgrlvlpkkfaeehggkkeesktltledesg.rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                           ++ l +pk+f+++h    ++sk  t+++++  +sW+v +    +  r+++++G ++ +++  L +gD ++Fkl++   fe+++ + 
  Bostr.19424s0967.1.p 235 LKFLAIPKHFVDDHLP--NKSKIFTVRHPNRiNSWKVLC--LVREIRTIFSGGYSKLAREYPLLVGDKCTFKLIK--PFEFLLVIS 314
                           35699*********63..467899999*8888*******..8888899************************987..555566555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.3E-1814119IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.6E-1614115IPR015300DNA-binding pseudobarrel domain
CDDcd100171.38E-1319111No hitNo description
PROSITE profilePS5086312.81619114IPR003340B3 DNA binding domain
SMARTSM010195.2E-1819114IPR003340B3 DNA binding domain
PfamPF023621.1E-1519111IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.1E-15223316IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-17223316IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.432223317IPR003340B3 DNA binding domain
CDDcd100172.25E-11224315No hitNo description
SMARTSM010191.1E-16226317IPR003340B3 DNA binding domain
PfamPF023626.2E-9234313IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGWNTGFDLI KQERKNLGFY KIFRSADISS ENMRAFPYNF ISRISEKDFS YKMVMRAQWG  60
KSWDMKVSRN TRCYYIEKCG WDQFVSDNAL GRNEFITFIH KGKMIFNVYI YEQNCREILV  120
PRKLLSMVSS SGIKREEGKC SYEVVKKEDE ETDESPGRVE IKITKKKTEE TITFKKKMKS  180
KRVKNGMERG ESSRGVELKV RKKKAEASNT SKKEKIKSNK VVNPEFKITI RKSYLKFLAI  240
PKHFVDDHLP NKSKIFTVRH PNRINSWKVL CLVREIRTIF SGGYSKLARE YPLLVGDKCT  300
FKLIKPFEFL LVISKKSREE ITYCMID*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4936182e-96AB493618.1 Arabidopsis thaliana At3g17010 mRNA for hypothetical protein, partial cds, clone: RAAt3g17010.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006299610.11e-179hypothetical protein CARUB_v10015789mg
SwissprotQ9LSP61e-137Y3701_ARATH; B3 domain-containing protein At3g17010
TrEMBLR0I7T01e-179R0I7T0_9BRAS; Uncharacterized protein
STRINGAT3G17010.11e-134(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56521135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17010.11e-129B3 family protein