PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.19424s0383.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family CPP
Protein Properties Length: 635aa    MW: 69257.8 Da    PI: 6.5934
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.19424s0383.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.54e-16346384240
                   TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                           ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk+
  Bostr.19424s0383.1.p 346 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKR 384
                           589**********************************97 PP

2TCR51.22.5e-16431469139
                   TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                           ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Bostr.19424s0383.1.p 431 RHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNA 469
                           589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.5E-18345386IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.337346471IPR005172CRC domain
PfamPF036381.4E-11348383IPR005172CRC domain
SMARTSM011143.7E-17431472IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.8E-12433469IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    Send to blast
MRDCLFLENM DTPQKSITQI GTPVSKLKVE DSPVFNYICS LSPIKSIKSI PIAQTLSSLN  60
FTSPPSVFTS PHAVSHNESR FRNQINSSDP SKDGVASNEV ASIGEQGEEE ALIEIESSQI  120
LKNDCNTPRV IIDAGDNGCC EDGGMDLQKM CDNVKAKSDT PDWETLISGS AELIYGSSSE  180
SEAFSCLLKR TSNSEARVHG GTMSTLEPVS NTYVANNESE SFDALSIRRC LDFAIPGNNQ  240
QTLGESSSSC VVPSIGLHLN AITMSSKDNN VANEYSFSGN IKDGLQSSTT PVLHLEHDIV  300
RENEIGKDAS QAVEEFPKSS ALKELNPISP KKKRRKSEQS GEGELSCKRC NCKKSKCLKL  360
YCECFAAGVY CIEPCSCIDC FNKRIHEDVV LATRKQIESR NPLAFAPKVI RSSDSIIEVG  420
DDTSKTPASA RHKRGCNCKK SNCLKKYCEC YQGGVGCSIN CRCEGCKNAF GRKDGSSFEQ  480
DEENEISGKS ETAKTQQNVE LFNPAAPPST PIPVRQALAQ LPISSNNRLI PPVSHFHHGV  540
FGSSSSGIYN IRKPEMSMLS HSRIETITED VDDMPENHLI QSPITNMKAV VSPNSKRVSL  600
PHLDSSESTP WRRNGGGRKL ILSIPTFPSL THHR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A8e-1734846812120Protein lin-54 homolog
5fd3_B8e-1734846812120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1330334KKKRR
2330335KKKRRK
3331335KKRRK
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00044PBMTransfer from AT3G22760Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.19424s0383.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0996530.0AY099653.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
GenBankAY1288370.0AY128837.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006299680.10.0protein tesmin/TSO1-like CXC 3
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLR0I7X40.0R0I7X4_9BRAS; Uncharacterized protein
STRINGBostr.19424s0383.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]