PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.18473s0162.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 357aa    MW: 40161.6 Da    PI: 5.7158
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.18473s0162.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260113.71.2e-3531129199
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           aCa+Ck +rr+C ++C+lapyfpaeqpk f+nvh+lFG+++++k+l+ l+e+++++am+s+++++ +r r Pv+G++gv ++lq  +  
  Bostr.18473s0162.1.p  31 ACASCKSQRRRCIRNCPLAPYFPAEQPKLFQNVHRLFGVRRIVKILELLDENQKPEAMKSIIFQSYVRDRSPVHGCLGVTQQLQYMIWM 119
                           7**************************************************************************************** PP

                DUF260  90 lkaelallke 99 
                           +++el++++ 
  Bostr.18473s0162.1.p 120 AEEELKAVNL 129
                           *****99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.94430131IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-3231127IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MSHRGPGERF LHLLIAVIIV LMTLKGGTSG ACASCKSQRR RCIRNCPLAP YFPAEQPKLF  60
QNVHRLFGVR RIVKILELLD ENQKPEAMKS IIFQSYVRDR SPVHGCLGVT QQLQYMIWMA  120
EEELKAVNLQ LQFYRSQQQN GQNQNHNHNH NNNQMIHELG SDNKPQEDVT SQLDLGMGLN  180
VNNNHGNVVT PFFSPLPVSE TQQPQMSYTY SCSEVNNNGY SPPAYNTDSS KEILTDSNNV  240
WGGQNRFLYN NNNGGVFSNQ NESCHEMKSN NGVMAIQSQL GNLKMVSNHQ QEEEEDPHEY  300
DEIHQFLEMI DDRQSIADSK EAYASSSGES LKEQTGESGE NELKSAATCF SLTSLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-23271417121LOB family transfactor Ramosa2.1
5ly0_B3e-23271417121LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.18473s0162.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738620.0AB473862.1 Arabidopsis thaliana ASL29 mRNA for ASYMMETRIC LEAVES2-like 29 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292170.10.0LOB domain-containing protein 27
SwissprotQ9STS61e-160LBD27_ARATH; LOB domain-containing protein 27
TrEMBLR0HMD70.0R0HMD7_9BRAS; Uncharacterized protein
STRINGBostr.18473s0162.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-151LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]