PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.18351s0410.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 121aa    MW: 14138.8 Da    PI: 9.8562
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.18351s0410.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26096.52.8e-3091081100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +C+ C +++++C+++C +a+yfp+e +k++  ++klFG+ n++++++++p+ee++++++s+++e++a+++ Pv+G +g++++l +++  
  Bostr.18351s0410.1.p   9 RCCICITKKKNCPRNCEYAEYFPSELKKQYDSANKLFGTPNIIRMMRRAPPEEKQMLATSIIMEGNAWIKYPVSGGFGMVRNLMWKIVL 97 
                           6**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                            ka l++l+e+
  Bostr.18351s0410.1.p  98 RKAYLHQLEEK 108
                           *****999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089120.8648109IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-249105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MEALRNHGRC CICITKKKNC PRNCEYAEYF PSELKKQYDS ANKLFGTPNI IRMMRRAPPE  60
EKQMLATSII MEGNAWIKYP VSGGFGMVRN LMWKIVLRKA YLHQLEEKIK EEKKMTELHL  120
*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.18351s0410.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006299784.22e-57LOW QUALITY PROTEIN: LOB domain-containing protein 8
SwissprotQ9ZUP01e-50LBD8_ARATH; LOB domain-containing protein 8
TrEMBLR0GAE31e-58R0GAE3_9BRAS; Uncharacterized protein
STRINGBostr.18351s0410.1.p3e-85(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122821432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G19510.16e-53LOB domain-containing protein 8