PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.18351s0282.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 169aa    MW: 18713.7 Da    PI: 5.2045
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.18351s0282.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.41.4e-123086561
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61
                          ++ +r+ +NRe+ArrsR RK++ i+ L+  + +L++ N++  + l   ++++ k ++
  Bostr.18351s0282.1.p 30 RKRKRMLSNRESARRSRMRKQKHIDDLTAQINQLSNDNRQILNSLTVTSQLYMKIQA 86
                          57899*********************************8877777666666666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-162690IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.9E-102775No hitNo description
PROSITE profilePS5021710.2082891IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.03E-123081No hitNo description
PfamPF001707.9E-103081IPR004827Basic-leucine zipper domain
CDDcd147022.59E-213182No hitNo description
PROSITE patternPS0003603348IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MASSSSTYRS SSSSDGVNNP SDSVVTVDER KRKRMLSNRE SARRSRMRKQ KHIDDLTAQI  60
NQLSNDNRQI LNSLTVTSQL YMKIQAENSV LTAQMSELST RLQSLNEIVD LVQSNGAGFG  120
VDQIDGCGFD DRTVGIDGYY DDMMTGVNHW GGLAYTNQPI MANDINMY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12950RKRKRMLSNRESARRSRMRKQK
24249RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00267DAPTransfer from AT2G18160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0072120.0AC007212.7 Arabidopsis thaliana chromosome 2 clone F8D23 map PhyB, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankBT0007000.0BT000700.1 Arabidopsis thaliana clone RAFL08-13-K01 (R11176) putative bZIP transcription factor (At2g18160) mRNA, complete cds.
GenBankAY1335450.0AY133545.1 Arabidopsis thaliana At2g18160/F8D23.6 mRNA, complete cds.
GenBankAY0372160.0AY037216.1 Arabidopsis thaliana At2g18160/F8D23.6 mRNA, complete cds.
GenBankAK2302440.0AK230244.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL23-13-A15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002886152.11e-104G-box binding factor 5
RefseqXP_010413979.11e-104PREDICTED: ocs element-binding factor 1-like
RefseqXP_010467622.11e-104PREDICTED: ocs element-binding factor 1-like
TrEMBLD7LB861e-104D7LB86_ARALL; G-box binding factor 5
STRINGfgenesh2_kg.3__3423__AT2G18162.11e-104(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18160.14e-99basic leucine-zipper 2