PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.18351s0138.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 263aa    MW: 28628.1 Da    PI: 6.964
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.18351s0138.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.57e-0991137551
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                           k  +r   NReA r++R++Kka+ + Le++v  L a N +L k+l+ 
  Bostr.18351s0138.1.p  91 KSKKRPLGNREAVRKYREKKKAKAASLEDEVMRLRAVNNQLLKRLQG 137
                           66788899**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.8E-1484155No hitNo description
SMARTSM003384.5E-1087154IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.73789136IPR004827Basic-leucine zipper domain
PfamPF077161.2E-1490144IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.85E-792136No hitNo description
CDDcd146863.27E-1195145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MDDGELEISN HEAFSNSNMG GELPPSSCSM DSFFDELLRD SHACTHTHTC NPSGPENTHT  60
HTCLHVHTKI LPAQSEDKVS TDDTSESSGK KSKKRPLGNR EAVRKYREKK KAKAASLEDE  120
VMRLRAVNNQ LLKRLQGQAA LEAEVTRLKC LLVDIRGRID GEIGAFPYRK PAVTNVPFSY  180
MMHPCNMQCD VDNLYCLQNG NNGEGASMNE QGLNGCEFDQ LQCLANQNGK EIPVCSNGIG  240
TFTVNGSSSN KRKGGPLAGK AV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1174790.0AK117479.1 Arabidopsis thaliana At2g16770 mRNA for putative bzip transcription factor atbzip23, complete cds, clone: RAFL17-09-E13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010467405.11e-175PREDICTED: uncharacterized protein LOC104747472
RefseqXP_010467406.11e-175PREDICTED: uncharacterized protein LOC104747472
SwissprotQ8GTS21e-170BZP23_ARATH; Basic leucine zipper 23
TrEMBLD7L8711e-175D7L871_ARALL; DNA binding protein
STRINGscaffold_303970.11e-175(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20362879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-165bZIP family protein