PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.18351s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family M-type_MADS
Protein Properties Length: 387aa    MW: 44500.7 Da    PI: 5.8506
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.18351s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF34.91.9e-111151343
                          --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
                SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                          +en+  r   + k r g++KK +EL +LCd+++++i+fs++
  Bostr.18351s0040.1.p 11 VENEKSRAKKLKKIRVGLMKKVKELTILCDVKACMIMFSPN 51
                          57888888889999*************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.339151IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-15160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-17493IPR002100Transcription factor, MADS-box
CDDcd002661.88E-22485No hitNo description
PfamPF003191.4E-121151IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MTIKKLKLAW VENEKSRAKK LKKIRVGLMK KVKELTILCD VKACMIMFSP NEVEPMVWPS  60
VEKARDLLDG FFALPEIEKN KKDMSLELYL KEKTEKVHEQ FMKTHKKHMD YVIDQLMVQL  120
HCGRRIDDLD LSEIYALISF SKDNIILRRK ELELVEYSPF RDPPVPPFEA QFEELKTTTN  180
DVFVRGVQVD DRAWKNDEET KRVSIGNALM GNQSQYLIDE WVFASPKPPK PRAWAYQQIE  240
MDMVSYNRNP NPVLYQANSS NGNPNLDIEP IGAPMLTFHG LVGSVSQQLQ HHSMIDNPTV  300
AMRQPRQHPF DFMNSEFGVK EEGSTVNNGD SQFHEGNNTI AINDGIRQES PPNGTIVGEY  360
NDEESNADVR SFDINKVWLS INNQHF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.18351s0040.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020887803.10.0LOW QUALITY PROTEIN: uncharacterized protein LOC110230145
TrEMBLV4NQI01e-158V4NQI0_EUTSA; Uncharacterized protein
STRINGBostr.18351s0040.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.11e-134AGAMOUS-like 48