PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.17775s0009.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 163aa    MW: 18927.1 Da    PI: 7.197
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.17775s0009.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.53.3e-1471120554
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                           +++rrk++NRe+ArrsR RK+ +++eL   v  L +eN++L  +l++  +
  Bostr.17775s0009.1.p  71 RKQRRKISNRESARRSRMRKQRQVDELWSQVMWLRNENHQLLHKLNHVLE 120
                           689***************************************99998655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-1367131IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.73769132IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.5E-1271121No hitNo description
Gene3DG3DSA:1.20.5.1705.9E-1171144No hitNo description
PfamPF001703.4E-1271121IPR004827Basic-leucine zipper domain
CDDcd147021.56E-1772122No hitNo description
PROSITE patternPS0003607489IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MQPSMNIFSL HGCPPSYLSH FPTSTPFCVN GQNPNPFYSF QTGVNSTQFM SLSNSTSDEA  60
EENHSDIINE RKQRRKISNR ESARRSRMRK QRQVDELWSQ VMWLRNENHQ LLHKLNHVLE  120
SHEKVIEENA QLKGETSELK NMISDMQLQN QSPFSCFRDD VV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18390RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00533DAPTransfer from AT5G38800Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026881e-144CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankAB0090481e-144AB009048.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K15E6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010496567.11e-108PREDICTED: basic leucine zipper 43
SwissprotQ9FMC27e-99BZP43_ARATH; Basic leucine zipper 43
TrEMBLR0H2481e-102R0H248_9BRAS; Uncharacterized protein
STRINGAT5G38800.12e-96(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G38800.11e-100basic leucine-zipper 43