PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.15697s0446.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 173aa    MW: 18714.1 Da    PI: 7.773
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.15697s0446.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.27.8e-45131121100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+Ca+dCv++pyfpa++p+kfanvh++FGasnv k+l++lp ++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ 
  Bostr.15697s0446.1.p  13 PCAACKLLRRRCAQDCVFSPYFPADEPQKFANVHRVFGASNVNKMLQELPINQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDV 101
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+a+lal+++e
  Bostr.15697s0446.1.p 102 LQAQLALAQAE 112
                           ******99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.25612113IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4413110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MKESSRKQGA ASPCAACKLL RRRCAQDCVF SPYFPADEPQ KFANVHRVFG ASNVNKMLQE  60
LPINQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID VLQAQLALAQ AEVVHLRVRH  120
STNFQGHGLC PDSPSSSGSP SSKQVSPQDN KGMFSHMDIV DEASLGESMW SC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-4991147112LOB family transfactor Ramosa2.1
5ly0_B4e-4991147112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.15697s0446.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738390.0AB473839.1 Arabidopsis thaliana ASL6 mRNA for ASYMMETRIC LEAVES2-like 6 protein, complete cds.
GenBankBT0150670.0BT015067.1 Arabidopsis thaliana At1g31320 gene, complete cds.
GenBankBT0156650.0BT015665.1 Arabidopsis thaliana At1g31320 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010478882.11e-125PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE91e-124LBD4_ARATH; LOB domain-containing protein 4
TrEMBLD7KL241e-122D7KL24_ARALL; LOB domain protein 4
STRINGBostr.15697s0446.1.p1e-125(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-95LOB domain-containing protein 4