PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.13671s0316.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GeBP
Protein Properties Length: 374aa    MW: 41538.2 Da    PI: 5.1416
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.13671s0316.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573129.41.4e-40157252297
                DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkife 90 
                           +fqr+w+e+Dei++LqGl+d+k++tg+sp+dd++++y+ +kksisf+vsk q++eK+ +LKkK++++  kak+g+ep+f k+hd+k+fe
  Bostr.13671s0316.1.p 157 YFQRVWTEDDEIAVLQGLMDYKNNTGVSPYDDTNGIYQLLKKSISFDVSKVQFMEKLMSLKKKYENNLGKAKDGEEPTFVKPHDRKAFE 245
                           79*************************************************************************************** PP

                DUF573  91 lskkiWg 97 
                           lsk +Wg
  Bostr.13671s0316.1.p 246 LSKLVWG 252
                           ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.0E-33158252IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MSRNRFNPHE DPPTASSSDE DEVDTSIGQG EEIEGNYSSE EDDVSSKNPA ALKNTVVVLA  60
GPTGKQVSDS ESGSEEETDS DFEPEKKDQF LTKPVSKTKD SLVKNLDSKK VKTSEKSVGK  120
RSRETDEGVS TDVKRVKKGS GQDEKKSGGG EETKKTYFQR VWTEDDEIAV LQGLMDYKNN  180
TGVSPYDDTN GIYQLLKKSI SFDVSKVQFM EKLMSLKKKY ENNLGKAKDG EEPTFVKPHD  240
RKAFELSKLV WGANGMALES AVKSTGKSKK SRKSKKVESV KQELDSSLPN GKKCEDEVTN  300
KGEVSLLGAL EIDTFVKSSL VKSLARFGVD ELAAQQGLTR LALEDKKRFE EQWKALQVRE  360
FEEILFAEER FHS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010492929.11e-165PREDICTED: mediator-associated protein 1-like
TrEMBLR0I1M21e-150R0I1M2_9BRAS; Uncharacterized protein
STRINGAT1G11510.11e-121(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.11e-100DNA-binding storekeeper protein-related transcriptional regulator