PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.13129s0253.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 151aa    MW: 17102.7 Da    PI: 10.1979
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.13129s0253.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.73.8e-1150107562
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                           k+ +r ++NR++A++sR +K+++++ L +++ eL  + + L+++le  +++  +l++e
  Bostr.13129s0253.1.p  50 KKLKRIISNRVSAQKSRWKKLQYVDALVKRSMELHRQGSVLRSQLEIATEQKRYLENE 107
                           899******************************************9988888777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.9E-1042107No hitNo description
SMARTSM003385.4E-1246110IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.16348111IPR004827Basic-leucine zipper domain
PfamPF001702.6E-950107IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-950106No hitNo description
CDDcd147031.06E-1151102No hitNo description
PROSITE patternPS0003605368IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MSFPVVATSF GVSQSGSQAG EKKGGYVHCE VEPGFTIRMR QNIDPATDPK KLKRIISNRV  60
SAQKSRWKKL QYVDALVKRS MELHRQGSVL RSQLEIATEQ KRYLENEQRQ LKECISARLQ  120
HCIDSDGIIE VYKAEIERLK KNMAPPTNLT *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9609741e-153AY960974.1 Arabidopsis thaliana activator of spomin LUC3 (ASML3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196333.22e-90Basic-leucine zipper (bZIP) transcription factor family protein
TrEMBLQ56FQ12e-90Q56FQ1_ARATH; Activator of spomin LUC3
STRINGAT5G07160.16e-90(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144181821
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07160.11e-93bZIP family protein