PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.13129s0150.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 132aa    MW: 15809.6 Da    PI: 6.8033
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.13129s0150.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.64e-112988463
                          XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                           kr rr+ +NRe+ArrsR R ++ ie L+  v++L a N+ L ++  +l++   +  +e+
  Bostr.13129s0150.1.p 29 EKRLRRMVSNRESARRSRMRERKMIEGLKMQVEQLMASNQLLSNKYTSLSEYNHQILQEN 88
                          59*****************************************99999999999988887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.3E-102486No hitNo description
SMARTSM003385.7E-82690IPR004827Basic-leucine zipper domain
PfamPF077163.1E-112777IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.1622891IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.61E-103082No hitNo description
CDDcd147021.98E-153179No hitNo description
PROSITE patternPS0003603348IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MFLQNPHDED FHVHDQYHHH QPSVAMDQEK RLRRMVSNRE SARRSRMRER KMIEGLKMQV  60
EQLMASNQLL SNKYTSLSEY NHQILQENSQ LKETVSSFQE YTIFYGKHDD MPGNINDFDL  120
NQQSPHQPTY W*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010491438.14e-58PREDICTED: light-inducible protein CPRF2
TrEMBLR0FLV46e-54R0FLV4_9BRAS; Uncharacterized protein
STRINGAT5G08141.14e-50(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17031811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08141.12e-49basic leucine-zipper 75