PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.12302s0127.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 432aa    MW: 45678.1 Da    PI: 9.9278
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.12302s0127.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.58.3e-15354406557
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                           +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+ +  ++ ++ +
  Bostr.12302s0127.2.p 354 RRQRRMIKNRESAARSRARKQAYTVELEAEVAKLKEENDKLQRKQAKIMEMQK 406
                           79***************************************988888877765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-13350414IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.346352415IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.4E-14354403No hitNo description
CDDcd147077.06E-28354408No hitNo description
SuperFamilySSF579596.06E-11354402No hitNo description
PfamPF001702.0E-12354406IPR004827Basic-leucine zipper domain
PROSITE patternPS000360357372IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MDCNMNFKNN SLGNEPPGDG GGGGGLSRSG LTRQGSIYSL TFDEFQSSLG KDFGSMNMDE  60
LLKNIWSAEE TQAMATGMVP NAGGGQEGLQ LQRQGSLTLP RTLSQKTVDQ VWKDLSKVGN  120
SGGGGTNLTQ AAQAQAQAQA QAQAQAQSQS QRQQTLGEVT LEEFLVRAGV VREEAQIAAK  180
AQIAENNKGG YFSNDANTGF SVGFQQPSPQ VVAAGVMGNI GAETADPLQV QGSSLPLNVN  240
GARSTYQQQP IMPKQPGFGY GTQIGQLNSP GIRGGGIMGL GDQSLTNNMG LVQGAAAAIP  300
GALGVGAVSP VTPLSSEGIG KSNGDSSSLS PSPYMFNGGV RGRKTGTVEK VVERRQRRMI  360
KNRESAARSR ARKQAYTVEL EAEVAKLKEE NDKLQRKQAK IMEMQKDQEM ELRNLQGGPK  420
KRLRRTESGP W*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00186DAPTransfer from AT1G45249Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0935450.0AF093545.1 Arabidopsis thaliana clone 2 abscisic acid responsive elements-binding factor (ABRE) mRNA, complete cds.
GenBankBT0264430.0BT026443.1 Arabidopsis thaliana At1g45249 mRNA, complete cds.
GenBankAB0171600.0AB017160.1 Arabidopsis thaliana mRNA for ABA-responsive element binding protein 1 (AREB1), complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010479095.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
SwissprotQ9M7Q40.0AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLF4HRC90.0F4HRC9_ARATH; Abscisic acid responsive elements-binding factor 2
STRINGAT1G45249.30.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.10.0abscisic acid responsive elements-binding factor 2