PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.12302s0042.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 326aa    MW: 35779.8 Da    PI: 6.534
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.12302s0042.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.48.8e-10199257563
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                           kr++r   NR +A rs +RK  ++ eLe+kv++L++e ++L  ++ +l+   ++l +e+
  Bostr.12302s0042.1.p 199 KRAKRILANRQSAARSKERKIRYTGELERKVQTLQNEATTLSAQVTMLQRGTSELNTEN 257
                           9***********************************************99999988887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.5E-14195259IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.645197260IPR004827Basic-leucine zipper domain
PfamPF001702.8E-8199257IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-10199254No hitNo description
SuperFamilySSF579591.27E-10199249No hitNo description
CDDcd147033.92E-21200248No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007231Biological Processosmosensory signaling pathway
GO:0008272Biological Processsulfate transport
GO:0009294Biological ProcessDNA mediated transformation
GO:0009652Biological Processthigmotropism
GO:0009970Biological Processcellular response to sulfate starvation
GO:0045596Biological Processnegative regulation of cell differentiation
GO:0051170Biological Processnuclear import
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
GO:0051019Molecular Functionmitogen-activated protein kinase binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MEGGGGPNQT ILSEIERMPE APRQRISHHR RARSETFFSG ESIDDLLLFD PSDIDFSSLD  60
FLNAPPPQPP TQPQASPMSV DSPSEETSSN GVPPNSLPPK PDGARFGRHV RSFSVDDSDF  120
FDDLGVTEDQ FTGKSLATSS GEKKKGNHHN RSSSMDGETS SASFNIESLL ASVSVKDGGK  180
KNMGMGGDRL AELALLDPKR AKRILANRQS AARSKERKIR YTGELERKVQ TLQNEATTLS  240
AQVTMLQRGT SELNTENKHL KMRLQALEQQ AELRDALNEA LRDELNRLKM AAESTMNQFG  300
NNKNQQMSTN GQPSCPSLMD FTKRG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00184DAPTransfer from AT1G43700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1172840.0AY117284.1 Arabidopsis thaliana putative VirE2-interacting protein VIP1 (At1g43700) mRNA, complete cds.
GenBankAY0858570.0AY085857.1 Arabidopsis thaliana clone 19086 mRNA, complete sequence.
GenBankAY0654530.0AY065453.1 Arabidopsis thaliana putative VirE2-interacting protein VIP1 (At1g43700) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002891267.10.0vire2-interacting protein VIP1
SwissprotQ9MA750.0VIP1_ARATH; Transcription factor VIP1
TrEMBLD7KNM80.0D7KNM8_ARALL; Vire2-interacting protein VIP1
STRINGfgenesh2_kg.1__3729__AT1G43700.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79932639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G43700.11e-168VIRE2-interacting protein 1