PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.1040s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family ARF
Protein Properties Length: 597aa    MW: 67312 Da    PI: 7.9232
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.1040s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.94.6e-24114214198
                          EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                          f k+lt sd++++g +++p+k+a+++     ++++  +++   +d++g++W++k+i+r++++r++lt+GW+ Fv a+++ +gD++vF   
  Bostr.1040s0030.1.p 114 FTKILTASDTSTHGGFSVPRKHATKClppldMSIPIPTQEFLSKDLHGKEWRFKHIFRGTPRRHLLTTGWSAFVTAKKIVAGDVFVFL-- 201
                          89****************************9445455568999*********************************************.. PP

                          SSSEE..EEEEE- CS
                   B3  86 grsefelvvkvfr 98 
                          + +++el+v+++ 
  Bostr.1040s0030.1.p 202 RGETGELRVGIRG 214
                          449999****986 PP

2Auxin_resp98.68.6e-33240319183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          a+ha++++++F+vvY+Pr+  s+Fvv+++k+++a+++k+ vG+Rf m+fe++d+ err+ Gt++gvs++++ +W++S+WrsL+
  Bostr.1040s0030.1.p 240 AMHAFDNQCMFTVVYKPRT--SQFVVSYDKFLDAMNNKFNVGSRFTMRFEGDDFFERRYFGTIIGVSNFSS-HWKDSEWRSLQ 319
                          789***************6..9**********************************************888.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.4E-36108226IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.57E-32111236IPR015300DNA-binding pseudobarrel domain
CDDcd100173.06E-22113213No hitNo description
PfamPF023625.7E-22114214IPR003340B3 DNA binding domain
SMARTSM010192.7E-23114216IPR003340B3 DNA binding domain
PROSITE profilePS5086312.731114216IPR003340B3 DNA binding domain
PfamPF065073.0E-29240319IPR010525Auxin response factor
PfamPF023093.5E-7478537IPR033389AUX/IAA domain
SuperFamilySSF542771.57E-12497577No hitNo description
PROSITE profilePS5174526.293501582IPR000270PB1 domain
PfamPF023091.2E-6540585IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MESGNVVDAH PEELLGIIDV TKSYMYEQLW KLCAGPLCDL PKLGEKVKAS TREELNEIQP  60
IFDLPSKLRC RVIAIQLKKN TDEVYAEIGL MPDTTEVIIP TQNNNKYRPI VNSFTKILTA  120
SDTSTHGGFS VPRKHATKCL PPLDMSIPIP TQEFLSKDLH GKEWRFKHIF RGTPRRHLLT  180
TGWSAFVTAK KIVAGDVFVF LRGETGELRV GIRGAGHQEG KIPSSLVSIE SMRNGVIASA  240
MHAFDNQCMF TVVYKPRTSQ FVVSYDKFLD AMNNKFNVGS RFTMRFEGDD FFERRYFGTI  300
IGVSNFSSHW KDSEWRSLQV QWDELASFPR PDKVSPWEIE HLTPSSNVLQ SSLLKNKRSR  360
TCSTSSHLLP PILTQGQEIG QPSMTSPMSI PQLSYRDAIE DAKTPSSCLR SYSVPPMPKL  420
NYNNDQMVTP IIENTTTVAG ASCRLFGVSL ATPSEIKDPM EPNDSYQISE ISKISQEKNF  480
ILTQTLTSPK EIQSKQFSST RSYTKVQMQG VTIGRALDLS VLNGYDQLIR ELEKLFDLKG  540
LLRTRNQWEI VFTDNEGDMM LVGDDPWPEF CNMVKKIFIC SKEEVKNLKS GNNLSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1172034914362Auxin response factor 1
4ldw_A1e-1172034914362Auxin response factor 1
4ldw_B1e-1172034914362Auxin response factor 1
4ldx_A1e-1172034914362Auxin response factor 1
4ldx_B1e-1172034914362Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.1040s0030.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010478873.10.0PREDICTED: putative auxin response factor 14 isoform X1
SwissprotQ9LQE80.0ARFN_ARATH; Putative auxin response factor 14
TrEMBLD7L9F70.0D7L9F7_ARALL; Auxin response factor
STRINGBostr.1040s0030.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35540.10.0auxin response factor 14