PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.10273s0324.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family M-type_MADS
Protein Properties Length: 261aa    MW: 29884 Da    PI: 5.1162
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.10273s0324.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF46.54.7e-15646343
                          --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
                SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                          ienk+ r +tf kR++g+ KK  EL +LCd++++ +i+s+ 
  Bostr.10273s0324.1.p  6 IENKTSRRTTFNKRKQGLKKKLTELVTLCDVKACGVIYSPY 46
                          9*************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.787144IPR002100Transcription factor, MADS-box
SMARTSM004322.8E-12155IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-20389IPR002100Transcription factor, MADS-box
CDDcd002663.40E-26480No hitNo description
PfamPF003193.8E-16646IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MRYSLIENKT SRRTTFNKRK QGLKKKLTEL VTLCDVKACG VIYSPYNPEP EAWPSREGVE  60
EVVSEFMEVS MKDRSKKMVD QETFLREMIA KEKAQLQKLR NENRKFQMQD IMWGCLKGEI  120
DVRKLGEKDL RDLSSFIDKY LNQLSCRIEN LTENGESSSS LPPLVVPDAL AKYQKQRKLF  180
QLQNDALLEF FGQIPKKIYD FNMNMNSNQN MILDLNQDLN VEEDGDIPSM DGSHHQPETD  240
CLAATAADAC APNITNNLES *
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of gametophytes and seeds.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.10273s0324.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by MEA in seeds, and by PKL after germination. {ECO:0000269|PubMed:12815071, ECO:0000269|PubMed:16359393}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020890945.11e-112MADS-box transcription factor PHERES 2
SwissprotQ7XJK81e-110PHE2_ARATH; MADS-box transcription factor PHERES 2
TrEMBLS6BIJ31e-108S6BIJ3_TURGL; Pheres1 (Fragment)
STRINGBostr.10273s0324.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.18e-89AGAMOUS-like 38
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]