PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.10040s0294.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 149aa    MW: 17034.4 Da    PI: 8.2219
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.10040s0294.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.91e-134895350
                          XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50
                          ++k+ +r ++NRe+A+rsR RKk++ eeL+e+v+ L   N++Lk +l 
  Bostr.10040s0294.1.p 48 DDKKSKRTISNRESAKRSRMRKKKRFEELTEEVARLNLRNQELKGRLL 95
                          589*****************************************8875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-1046117IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-114894No hitNo description
PROSITE profilePS5021710.2314894IPR004827Basic-leucine zipper domain
PfamPF001706.4E-114994IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.33E-85094No hitNo description
PROSITE patternPS0003605368IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MFSTNLEPVH ICFNDATITG EEITEILAFL QSDKSDNPSG SNELVPVDDK KSKRTISNRE  60
SAKRSRMRKK KRFEELTEEV ARLNLRNQEL KGRLLNVVSC GNVISNENNR LKTESVHLEI  120
RLLELYRFLV AIQSPISTRV NYITELEI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16267KRSRMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010511042.14e-78PREDICTED: basic leucine zipper 1-like
TrEMBLA0MED35e-76A0MED3_ARATH; Putative uncharacterized protein (Fragment)
TrEMBLQ9LQ654e-76Q9LQ65_ARATH; BZIP transcription factor family protein
STRINGAT1G59530.11e-75(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122322432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59530.11e-78basic leucine-zipper 4