PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.0697s0074.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 392aa    MW: 42935.2 Da    PI: 6.3826
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.0697s0074.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.81.3e-14217271357
                          XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                          ++kr+rr+ +NRe+ArrsR+RK++++ e  + v +L ae ++L ++l+ ++ +++
  Bostr.0697s0074.1.p 217 DVKRARRMLSNRESARRSRRRKQEQMNEFDTQVGQLRAEHSTLLNRLSDMNHKYD 271
                          68******************************************77776666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.5E-16215279IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.8E-10216269No hitNo description
PROSITE profilePS5021710.668217271IPR004827Basic-leucine zipper domain
PfamPF001707.0E-12218271IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.14E-10219269No hitNo description
PROSITE patternPS000360222237IPR004827Basic-leucine zipper domain
PfamPF124982.1E-13286370IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MHIVFSVDDL TESFWPVPAS APSQGSTPTP APAQNMADGM TRSQSEWAFH RLLNELSGSD  60
SSPAPVQSLS RVEETVDETE DVVEIQKPQS HHRLPTDDQG NRNRAPSSDP LDSAGVDPNQ  120
YHAILKSKLE LACAAVARRV GTVKPEDSSA SASNQKQTQG STVAQTSPGA SSVRFSSSTS  180
TQKKPDVPAR QTTSISSRDD SDDDDLDGDA DNGDPTDVKR ARRMLSNRES ARRSRRRKQE  240
QMNEFDTQVG QLRAEHSTLL NRLSDMNHKY DAAAVDNRIL RADIETLRTK VKMAEETVKR  300
VTGVNPLHWA RPNMGIPFNN TPSAPSRIPP NSNHILKPAI PSTTTSAGLA PNQIVETANF  360
LPEQVNREGM QNPFTPDSNL YEALSHWNHK H*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1231238RRSRRRKQ
2233238SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0575090.0AY057509.1 Arabidopsis thaliana bZIP transcription factor-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002877990.10.0hypothetical protein ARALYDRAFT_906872
SwissprotQ9M1G60.0BZP25_ARATH; Basic leucine zipper 25
TrEMBLD7LUW00.0D7LUW0_ARALL; Putative uncharacterized protein
STRINGscaffold_502576.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58482645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54620.10.0basic leucine zipper 25