PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.0597s0095.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family CPP
Protein Properties Length: 671aa    MW: 73622.2 Da    PI: 5.2257
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.0597s0095.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.63.8e-16373411240
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Bostr.0597s0095.1.p 373 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 411
                          689**********************************96 PP

2TCR51.12.6e-16458496139
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                          ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Bostr.0597s0095.1.p 458 RHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNA 496
                          589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19372413IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.543373498IPR005172CRC domain
PfamPF036386.4E-12375410IPR005172CRC domain
SMARTSM011143.7E-17458499IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.0E-11460496IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 671 aa     Download sequence    Send to blast
MDTPQKSITQ IGTPISKSRF EDSPVFNYIN SLSPIRPVKS TQNPHQFSSL NFTSPPSVFT  60
SPHLTSSHKE SRFFKTHNSS SHPTNPVESR EDESTSNEEV VPEAEDTKDL NIDVSMREEA  120
LIETNPDDNP VSSPCGRDTT DLSLVPYAPP RGENGSCEDA GMELQKMYDN VQGETETPDW  180
ESLISDASEL LIFDSPDASE AFRCIMMQRA STSGARFSTG VEMQTMQPNS NKEPESSDAI  240
PYEAVSLLHR GIRRRCLDFE MPGNKQTLSE NNTAACESSS RCVVPSIGLH LNAIAMSSKD  300
CKTNVTRDYS CSGNIQVGLQ SSISTLQETL DQTENETRED ADQDVPVEPA LQELNLGSPK  360
KKRVKLDSGE GESCKRCNCK KSKCLKLYCE CFAAGVYCIE PCSCIDCFNK PIHEDTVLAT  420
RKQIESRNPL AFAPKVIRNS ESVLETGDDA SKTPASARHK RGCNCKKSNC LKKYCECYQG  480
GVGCSINCRC EGCKNAFGRK DGSFIVDMEA EQEEENETSE KNRTAKTQQN NEVLMRKEAS  540
SALPTTPTPI YRQLVQLPFS SSKNMMPPPQ SLLGGGSSSG TYIRKPDISL TQSRIEKSFE  600
TVAEDGAEEM PEILIHSPIP NIKSVSPNGK RVSPPHMESS SPGSILGRRS GGRKLILQSI  660
PSFPSLTPQH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-1737749514120Protein lin-54 homolog
5fd3_B3e-1737749514120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1358365PKKKRVKL
2358366PKKKRVKLD
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.0597s0095.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1615390.0AL161539.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 39.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankZ973370.0Z97337.2 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020872377.10.0protein tesmin/TSO1-like CXC 2 isoform X1
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLR0F1B10.0R0F1B1_9BRAS; Uncharacterized protein
STRINGBostr.0597s0095.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.10.0TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]