PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.0568s0123.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family Nin-like
Protein Properties Length: 278aa    MW: 32259.6 Da    PI: 6.5383
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.0568s0123.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.44.4e-26157206352
               RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          +++s e++++yF++pi++AAkeL+++ T+LK++CR++GI+RWPhRk++sl
  Bostr.0568s0123.1.p 157 NSLSREMMKQYFYMPIAKAAKELNIGITLLKKRCRELGIPRWPHRKLTSL 206
                          67999******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.803142226IPR003035RWP-RK domain
PfamPF020421.8E-21159206IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MADPNPLMNW SEANNYESFL QEDIFSFLDQ SLFLDHNSFV NPFKDFQTQS WFSSQDSIVN  60
PMSTTFATDH TFLASLDLEA ISSTFSLDVL SGSWNENNSN YNNQVEPILD EILRSANSIG  120
DPNMEKIMHE DDNTIKETTS QKRMIMKRRY REDGVINSLS REMMKQYFYM PIAKAAKELN  180
IGITLLKKRC RELGIPRWPH RKLTSLNALI TNLKDLLRNT EGETNKSKLR NALELLEMEK  240
KMIEEVPDLE FGEKTKRLRQ ACFKANYKRR RLFSPSS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1267271KRRRL
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.0568s0123.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266401e-134AB026640.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K8A10.
GenBankCP0026881e-134CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006281487.11e-171protein RKD3
SwissprotQ9FGD11e-165RKD3_ARATH; Protein RKD3
TrEMBLR0GPV51e-170R0GPV5_9BRAS; Uncharacterized protein
STRINGBostr.0568s0123.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121801932
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.11e-156RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Tedeschi F,Rizzo P,Rutten T,Altschmied L,Bäumlein H
    RWP-RK domain-containing transcription factors control cell differentiation during female gametophyte development in Arabidopsis.
    New Phytol., 2017. 213(4): p. 1909-1924
    [PMID:27870062]