PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.0568s0111.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 320aa    MW: 35291.4 Da    PI: 7.13
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.0568s0111.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.41.2e-4371061100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC+++Cv+apyfp +qp+kfa+vhk+FGasnv kll++l  ++reda++sl+yeAear+rdPvyG+vg+i+ lq++l+ql
  Bostr.0568s0111.1.p   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFAYVHKVFGASNVAKLLNELASNQREDAVNSLFYEAEARLRDPVYGCVGLISILQHRLKQL 96 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +++l+ +k+e
  Bostr.0568s0111.1.p  97 QHDLENAKKE 106
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381552.0E-1084316IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089126.9086107IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MASSSSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFAYVH KVFGASNVAK LLNELASNQR  60
EDAVNSLFYE AEARLRDPVY GCVGLISILQ HRLKQLQHDL ENAKKELATY VGPQAMLPIL  120
QPPQPHFMSL PPQPQRPSSS SSASVLTQHH HHNLLPMMAI PTGQLYQQQQ QQQIFEAQQL  180
AAVNAVAREQ QNEMFRAYGG GSSSPHHQNQ AQVEILRFNN GFDSVPAGSV TVTGFNQLSS  240
GGTAVTGMSL GGNFVDSPST NNNYHTDQQL HHHHQQQHHE AQLFIPTQSS QPLPLQTQET  300
QTQTQPNSES EEGRRGVIG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-4941108114LOB family transfactor Ramosa2.1
5ly0_B6e-4941108114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.0568s0111.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0107000.0AB010700.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MUD21.
GenBankAB1643030.0AB164303.1 Arabidopsis thaliana ASL1 mRNA for ASYMMETRIC LEAVES2-like gene 1 protein, complete cds.
GenBankAB4738340.0AB473834.1 Arabidopsis thaliana ASL1 mRNA for ASYMMETRIC LEAVES2-like 1 protein, complete cds.
GenBankBT0440580.0BT044058.1 Arabidopsis thaliana unknown protein (At5g66870) mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280835.10.0LOB domain-containing protein 36
SwissprotQ9FKZ31e-178LBD36_ARATH; LOB domain-containing protein 36
TrEMBLR0GRB40.0R0GRB4_9BRAS; Uncharacterized protein
STRINGBostr.0568s0111.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80082441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-150ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]