PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.0556s0629.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 173aa    MW: 20222.4 Da    PI: 6.5229
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.0556s0629.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.48.3e-1580134559
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                          +++rr+++NRe+ArrsR RK+  ++eL   v  L  eN++L ++l++l++  +k+
  Bostr.0556s0629.1.p  80 RKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNLSESHDKV 134
                          689******************************************9999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-1476140IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.92178141IPR004827Basic-leucine zipper domain
PfamPF001704.8E-1380133IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.7E-1180153No hitNo description
SuperFamilySSF579591.19E-1280132No hitNo description
CDDcd147022.57E-1981132No hitNo description
PROSITE patternPS0003608398IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MEPQTDVFRL YNYLNSSIRS PYPSNFPIST PFPNNGQNPN PLYGFQSPTN NPQSMSLSSN  60
NSTSDEAEEH QKNNNIINER KQRRMISNRE SARRSRMRKQ RHLDELWSQV MWLRIENHQL  120
LDKLNNLSES HDKVVQENAQ LKEETSELKQ VISDMQIQSP FSCFRDDIIP LE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19299RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAPTransfer from AT3G30530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankAB0168780.0AB016878.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MQP15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189674.11e-112basic leucine-zipper 42
SwissprotQ9FMC26e-67BZP43_ARATH; Basic leucine zipper 43
TrEMBLQ9LW451e-112Q9LW45_ARATH; Basic leucine-zipper 42
STRINGAT3G30530.11e-111(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.11e-102basic leucine-zipper 42