PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.0556s0333.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 122aa    MW: 13675.8 Da    PI: 8.5764
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.0556s0333.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.41.8e-4151051101
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+C+kdC+++pyfp ++p+kfa++h+++Ga nv+k+l++lp+++r +a++sl++eA++r++dPvyG+vg+i+ lq q++++
  Bostr.0556s0333.1.p   5 RCAACKYLRRRCPKDCIFSPYFPPNDPEKFACIHRIYGAGNVSKMLQQLPDQTRAEAVESLCFEAKCRVDDPVYGCVGIISLLQTQIQKT 94 
                          6***************************************************************************************** PP

               DUF260  91 kaelallkeel 101
                          +++la++++e+
  Bostr.0556s0333.1.p  95 QNQLAKTQAEI 105
                          ******99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.334105IPR004883Lateral organ boundaries, LOB
PfamPF031955.9E-415102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MNPKRCAACK YLRRRCPKDC IFSPYFPPND PEKFACIHRI YGAGNVSKML QQLPDQTRAE  60
AVESLCFEAK CRVDDPVYGC VGIISLLQTQ IQKTQNQLAK TQAEIAVAQT KLSQTQNSEF  120
M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-39610512111LOB family transfactor Ramosa2.1
5ly0_B4e-39610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.0556s0333.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738461e-154AB473846.1 Arabidopsis thaliana ASL13 mRNA for ASYMMETRIC LEAVES2-like 13 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189300.14e-83LOB domain-containing protein 24
SwissprotP594684e-84LBD24_ARATH; LOB domain-containing protein 24
TrEMBLR0FT524e-80R0FT52_9BRAS; Uncharacterized protein
STRINGBostr.0556s0333.1.p8e-86(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-86LOB domain-containing protein 24